DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-1 and SDG37

DIOPT Version :9

Sequence 1:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_849969.2 Gene:SDG37 / 816300 AraportID:AT2G17900 Length:485 Species:Arabidopsis thaliana


Alignment Length:433 Identity:98/433 - (22%)
Similarity:182/433 - (42%) Gaps:65/433 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IAHNEQLGRHLVATRTIKPYEIVLKEAPLVRGPAQISAPV-CLGCL--NGIEAEDHIECEQCG-- 104
            :::..|.||.|...|..:|.|::|.:.|.:..|...|:.. |.||.  |.::     :|..|.  
plant    20 VSNLPQKGRSLFTARDFRPGEVILSQKPYICVPNNTSSESRCDGCFKTNNLK-----KCSACQVV 79

  Fly   105 WPLCGPECKSLD--EHKAEC-GLTKDRGQKVNVQEFGGPHPLYTCLSTVRCLLIGETSTEK---- 162
            | .||..|:..:  .|:.|| .||:...:|   ::|..|    |....||..:......||    
plant    80 W-YCGSSCQKSEWKLHRDECKALTRLEKEK---RKFVTP----TIRLMVRLYIKRNLQNEKVLPI 136

  Fly   163 --ASKFQDLESLESTRRGSNQWK----ADLVSIGQFIPKFFKTQKFTEEEIMKAVGALQINGHEV 221
              ...:..:|:|.|.....::.:    |.:.::...|.:|   ......||.:.......|.|.:
plant   137 TTTDNYSLVEALVSHMSEIDEKQMLLYAQMANLVNLILQF---PSVDLREIAENFSKFSCNAHSI 198

  Fly   222 PTTD--PSHVAVFYTASFTENSCLPNLAKSFNKNGHCILWAPREIKKNAHLSICYSDAMWGTADR 284
            ..::  |..:.:|...|...:||.||....|.:. ..::.|...|.|::.::|.|.:....|..|
plant   199 CDSELRPQGIGLFPLVSIINHSCSPNAVLVFEEQ-MAVVRAMDNISKDSEITISYIETAGSTLTR 262

  Fly   285 QRHLMQTKLFKCACERCVDVTE-LDTNYSAI----KCEDRQCGGLMLPTKADEWNGSWRCRECHK 344
            |:.|.:..||.|.|.||.:..: .|...|||    :|.:.:|.|.:|   .|.....:.|::|..
plant   263 QKSLKEQYLFHCQCARCSNFGKPHDIEESAILEGYRCANEKCTGFLL---RDPEEKGFVCQKCLL 324

  Fly   345 QVQKHYVERILERAGKDIQSMEKIA---------ENGLKYLKHYEKWLPPQHFHMSEIKILLVQL 400
            ...|..|:::    ..|::::.:.|         :..::..|..|| |..:.:|...|.::..: 
plant   325 LRSKEEVKKL----ASDLKTVSEKAPTSPSAEDKQAAIELYKTIEK-LQVKLYHSFSIPLMRTR- 383

  Fly   401 LAKDQKELMVIPDDRLLLK-LNFARELVELYEKLTPCEVRTLG 442
                :|.|.::.|..:..: ||:.|.:|.:|:::.|.....:|
plant   384 ----EKLLKMLMDVEIWREALNYCRLIVPVYQRVYPATHPLIG 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009
SDG37NP_849969.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.