DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-1 and AT1G26761

DIOPT Version :10

Sequence 1:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001117357.1 Gene:AT1G26761 / 6241260 AraportID:AT1G26761 Length:444 Species:Arabidopsis thaliana


Alignment Length:47 Identity:11/47 - (23%)
Similarity:22/47 - (46%) Gaps:12/47 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KIAHNEQLGRHLVA----------TRTIKPYEIVLKEAPLVRGPAQI 80
            |:..:|.:|  ||.          |.:::|.|:|:..:..||..:.:
plant   134 KVESSEDVG--LVMSCGEDWWGFDTASVRPGEVVIMSSSKVRANSSV 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:460312
SET_SMYD <217..301 CDD:380997
AT1G26761NP_001117357.1 GH43_62_32_68_117_130 <99..>130 CDD:449341
GH43_62_32_68_117_130 202..430 CDD:449341
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.