DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-1 and Zmynd15

DIOPT Version :10

Sequence 1:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001025100.1 Gene:Zmynd15 / 574428 MGIID:3603821 Length:736 Species:Mus musculus


Alignment Length:124 Identity:34/124 - (27%)
Similarity:43/124 - (34%) Gaps:39/124 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CHVCE----EPTKNKCSNCNQVSYCSVQHQKQDWK------VHKPSCHPFKIAHNEQLGR--HLV 56
            ||||.    |.....|..|:.|.||.....:.||:      .|:..| |...|..|::|.  .|.
Mouse   307 CHVCHKHSFEVKLTPCPQCSAVLYCGEACLQADWRRCPDDVSHRFWC-PRLSAFMERVGELASLP 370

  Fly    57 ATRTIK-PYEIVLKEA----------------PLVRGP-------AQISAPVCLGCLNG 91
            .|.|.: ..|...|||                .|:.||       ...|:..||  |||
Mouse   371 FTYTAEVTSETFNKEAFLASRGLTRGYWTQLSMLIPGPGAPRYPWGSTSSLSCL--LNG 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:460312 13/45 (29%)
SET_SMYD <217..301 CDD:380997
Zmynd15NP_001025100.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..94
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..192
zf-MYND 307..353 CDD:460312 13/45 (29%)
MSS51_C 478..672 CDD:466330
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..583
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 696..736
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.