DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-1 and Smyd5

DIOPT Version :9

Sequence 1:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster


Alignment Length:376 Identity:75/376 - (19%)
Similarity:121/376 - (32%) Gaps:133/376 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FKIAHNEQLGRHLVATRTIKPYEIVLKEAPLVRGPAQISAPVCLG------CLNGIE-------- 93
            |:|......||.::||:.....|::.:|.|.|  ..|.|..|..|      |:..:|        
  Fly     4 FEIRELPGKGRAMIATKNFAKDEVIFEEEPFV--SRQFSWNVAYGYAACDHCMRPLETVLENVRR 66

  Fly    94 -AED-------------------HIECEQCGWPLCGPECKSLDE-----HKAEC--GLTKDRGQK 131
             |.|                   ..:|.:|....|..:|  |.|     |:..|  ....|....
  Fly    67 LASDPKVEVPLLQHDPTAQWVAQFTQCPRCKVRYCSEDC--LMEAQKRYHRVACMGAFHSDDTHP 129

  Fly   132 VNV-----QEFGGPHPLYTCLSTVRCLLIGETSTEKASKFQDLESLESTRRGSNQWKADLVSIGQ 191
            :||     ::...|....:.:..||.:.:.:.||:|....:.|:|.:|.          :|:..|
  Fly   130 INVLNETWKKMHYPPETGSIMLIVRLMALYQQSTKKEEFLEQLQSFQSL----------IVNREQ 184

  Fly   192 -----FIPKFFKTQ----------KFTEEE--IMKAVGA----LQING----------------- 218
                 .:.:.|:.|          .||.||  |.|...|    :.|.|                 
  Fly   185 KIYHKMLGENFEQQMEQLYLAFCNAFTGEEFSIFKTPDAFKTLMAILGTNSQGIATSVLSQWVAK 249

  Fly   219 -HEVPTTDPSH--------------------------VAVFYTASFTENSCLPNLAKSF-NKNGH 255
             .::|.||...                          ..::...|...:||:||...:| ..|..
  Fly   250 VSDLPLTDSEKEQLDTVIDGLYAKVGEFAGEFLNNEGSGLYLLQSKINHSCVPNACSTFPYSNDI 314

  Fly   256 CILWAPREIKKNAHLSICYSDAMWGTADRQRH-----LMQTKLFKCACERC 301
            .:|.|...|::...:.|.|.|..  ..:|.||     |.:..:|.|.|.:|
  Fly   315 VVLKALAPIQQGEEICISYLDEC--MLERSRHSRHKVLRENYVFICQCPKC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009 7/32 (22%)
SET <296..333 CDD:279228 10/36 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.