DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-1 and Smyd5

DIOPT Version :9

Sequence 1:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001101340.1 Gene:Smyd5 / 312503 RGDID:1309153 Length:417 Species:Rattus norvegicus


Alignment Length:394 Identity:75/394 - (19%)
Similarity:120/394 - (30%) Gaps:156/394 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GRHLVATRTIKPYEIVLKEAPLVRGP----AQISAPVCLGCLNGIE-AED--------------- 96
            |:.|.||:.|:..|.:..|.|||...    |......|..||..:| ||:               
  Rat    33 GKGLFATQLIRKGETIFIERPLVASQFLWNALYRYRACDHCLRALEKAEENAQRLTGKPGQVLPH 97

  Fly    97 ----------HIECEQCGWPLCGPECK---SLDEHKAEC-GLTKDRGQKVNVQEFGGPHPL---- 143
                      |..|.:|....|..||:   :...|:..| |.::|..:          |||    
  Rat    98 PELCSVRKDLHQNCPRCQVTYCSAECRLAAAEQYHQILCPGPSQDDPR----------HPLNKLQ 152

  Fly   144 -------YTCLSTVRCLLIGETSTEKASKFQD-----------------------------LESL 172
                   |...:....|:....:|.|.:|.:|                             ...|
  Rat   153 EAWRSVHYPPETASIMLMARMVATVKQAKDKDHWVRLFSHFCSKTANEEEEIVHKLLGDKFKGQL 217

  Fly   173 ESTRR---------------------------GSN----------QW----------KADLVSIG 190
            |..||                           |:|          ||          ..:...:.
  Rat   218 ELLRRLFTEALYEETLSQWFTPDGFRSLFALVGTNGQGIGTSSLSQWVHACDALELKPQEREQLD 282

  Fly   191 QFIPKFFKTQKFTEEEIMKAVGALQINGHEVPTTDPSHVAVFYTASFTENSCLPNLAKSFNKNGH 255
            .||.:.:|..:....|.:...|:                .:|...|...:||:||...||.:|..
  Rat   283 TFIDQLYKDIEAATGEFLNCEGS----------------GLFVLQSCCNHSCVPNAETSFPENNF 331

  Fly   256 CI-LWAPREIKKNAHLSICYSDAMWGTADRQRH-----LMQTKLFKCACERCVDVTELDTNYSAI 314
            .: :.|..:|:....:.|.|.|..  ..:|.||     |.:..||.|:|.:|:...: |.|.::.
  Rat   332 LLHVTALEDIEPGEEICISYLDCC--QRERSRHSRHKILRENYLFVCSCPKCLAEAD-DPNVTSE 393

  Fly   315 KCED 318
            :.|:
  Rat   394 EEEE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009
Smyd5NP_001101340.1 DUF4599 68..144 CDD:292015 16/75 (21%)
SET <298..351 CDD:214614 14/68 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.