DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-1 and set5

DIOPT Version :9

Sequence 1:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_588413.1 Gene:set5 / 2538853 PomBaseID:SPCC1739.05 Length:319 Species:Schizosaccharomyces pombe


Alignment Length:290 Identity:53/290 - (18%)
Similarity:97/290 - (33%) Gaps:96/290 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 SKFQDLESLESTRRGSNQ------WKADLVSIGQFIPKFFKTQKFTEEEIMKAVGALQINGHEVP 222
            |..:::|...||:....|      :.|...::|.|:..|:.             .||        
pombe    44 SDAKEIEEALSTKTKEEQEAFHRLFNAHPDTMGPFLGPFYS-------------NAL-------- 87

  Fly   223 TTDPSHVAVFYTASFTENSCLPNLAKSFN-KNGHCILWAPREIKKNAHLSICYSDAMWGTADRQR 286
            |.|.:...:|...|...:.|.||:..::| :.....:.|.|:|:....:...|.|......:||:
pombe    88 TIDETKGGMFLLGSRMNHDCSPNVKHTWNPRLDQVTVHAVRDIEAGEEILTTYIDLHKSHTERQK 152

  Fly   287 HLMQTKLFKCACERCVDVTELDTNYSAIKCEDRQCGGLMLPTKADEWNGSWRCRECHKQVQKHYV 351
            .|::...|||.|..|                                           .|::..:
pombe   153 ILLEHFGFKCYCSVC-------------------------------------------SVEERKI 174

  Fly   352 ERILERAGKDI----QSMEKIA----ENGLKYLKHYEKWLPPQHFHMSEIKIL-----LVQLLAK 403
            .:|.:...|.:    ::|.|:.    ...|:.|:|        ..|::..::|     ::.||  
pombe   175 RKISDLRRKQLAYYDRTMAKMCIVNPRGALRALRH--------RIHIAHEELLFGRLDIIALL-- 229

  Fly   404 DQKELMVIPDD--RLLLKLNFARELVELYE 431
            |...|.||..|  |..:......:.:.|||
pombe   230 DAFRLCVIHGDFERASIFAKKGTKAISLYE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009
set5NP_588413.1 SET <1..319 CDD:225491 53/290 (18%)
SET 4..147 CDD:214614 24/123 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.