DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-1 and Smyd5

DIOPT Version :9

Sequence 1:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_659167.2 Gene:Smyd5 / 232187 MGIID:108048 Length:416 Species:Mus musculus


Alignment Length:383 Identity:81/383 - (21%)
Similarity:126/383 - (32%) Gaps:135/383 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GRHLVATRTIKPYEIVLKEAPLVRGP----AQISAPVCLGCLNGIE-AED--------------- 96
            |:.|.||:.|:..|.:..|.|||...    |......|..||..:| ||:               
Mouse    33 GKGLFATQLIRKGETIFIERPLVAAQFLWNALYQYRACDHCLRALEKAEENAQRLTGKPSQILPH 97

  Fly    97 ----------HIECEQCGWPLCGPECK---SLDEHKAEC-GLTKDRGQKVN-VQE-FGGPH-PLY 144
                      |..|..|....|..||:   :...|:..| |.:.|....:| :|| :...| |..
Mouse    98 PELCSVRKDLHQNCPHCQVMYCSAECRLAAAEQYHQILCPGPSHDPRHPLNKLQEAWRSVHYPPE 162

  Fly   145 TC--------LSTVR---------------C------------------------LLIG---ETS 159
            |.        ::||:               |                        ||:|   |..
Mouse   163 TASIMLMARMVATVKQAKDKDHWVRLFNHFCSRTANQEQAIVHKLLKGKFKDQLELLLGLFKEAL 227

  Fly   160 TEKA-------SKFQDLESLESTR------RGSNQW----------KADLVSIGQFIPKFFKTQK 201
            .|:|       ..|:.|.:|..|.      ...:||          ..|...:..||.:.:|..:
Mouse   228 YEEALSLWFTPEGFRSLFALVGTNGQGIGTSSLSQWVHACDALELTPQDREQLDTFIDQLYKDIE 292

  Fly   202 FTEEEIMKAVGALQINGHEVPTTDPSHVAVFYTASFTENSCLPNLAKSFNKNGHCI-LWAPREIK 265
            ....|.:...|:                .:|...|...:||:||...||.:|...: :.|..:||
Mouse   293 AATGEFLNCEGS----------------GLFVLQSCCNHSCVPNAETSFPENNFVLHVTALEDIK 341

  Fly   266 KNAHLSICYSDAMWGTADRQRH-----LMQTKLFKCACERCVDVTELDTNYSAIKCED 318
            ....:.|.|.|..  ..:|.||     |.:..||.|:|.:|:...: |.|.::.:.|:
Mouse   342 PGEEICISYLDCC--QRERSRHSRHKILRENYLFNCSCPKCLAEAD-DPNVTSEEEEE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009
Smyd5NP_659167.2 SET <297..350 CDD:214614 15/68 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..416 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.