DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-1 and SMYD5

DIOPT Version :9

Sequence 1:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_006053.2 Gene:SMYD5 / 10322 HGNCID:16258 Length:418 Species:Homo sapiens


Alignment Length:379 Identity:75/379 - (19%)
Similarity:111/379 - (29%) Gaps:157/379 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GRHLVATRTIKPYEIVLKEAPLVRGP----AQISAPVCLGCLNGIE-AED--------------- 96
            |:.|.||:.|:..|.:..|.|||...    |......|..||..:| ||:               
Human    33 GKGLFATQLIRKGETIFVERPLVAAQFLWNALYRYRACDHCLRALEKAEENAQRLTGKPGQVLPH 97

  Fly    97 ----------HIECEQCGWPLCGPECK---SLDEHKAEC-GLTKDRGQKVNVQEFGGP-HPL--- 143
                      |..|..|....|..||:   :...|:..| |.::|           .| |||   
Human    98 PELCTVRKDLHQNCPHCQVMYCSAECRLAATEQYHQVLCPGPSQD-----------DPLHPLNKL 151

  Fly   144 --------YTCLSTVRCLLIGETSTEKASKFQD-----------------------------LES 171
                    |...:....|:....:|.|.:|.:|                             ...
Human   152 QEAWRSIHYPPETASIMLMARMVATVKQAKDKDRWIRLFSQFCNKTANEEEEIVHKLLGDKFKGQ 216

  Fly   172 LESTRR---------------------------GSN----------QW----------KADLVSI 189
            ||..||                           |:|          ||          ..|...:
Human   217 LELLRRLFTEALYEEAVSQWFTPDGFRSLFALVGTNGQGIGTSSLSQWVHACDTLELKPQDREQL 281

  Fly   190 GQFIPKFFKTQKFTEEEIMKAVGALQINGHEVPTTDPSHVAVFYTASFTENSCLPNLAKSFNKNG 254
            ..||.:.:|..:....|.:...|:                .:|...|...:||:||...||.:|.
Human   282 DAFIDQLYKDIEAATGEFLNCEGS----------------GLFVLQSCCNHSCVPNAETSFPENN 330

  Fly   255 HCI-LWAPREIKKNAHLSICYSDAMWGTADRQRH-----LMQTKLFKCACERCV 302
            ..: :.|..:||....:.|.|.|..  ..:|.||     |.:..||.|:|.:|:
Human   331 FLLHVTALEDIKPGEEICISYLDCC--QRERSRHSRHKILRENYLFVCSCPKCL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009
SMYD5NP_006053.2 SET <298..351 CDD:214614 15/68 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.