DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp20-33 and USP18

DIOPT Version :9

Sequence 1:NP_610943.2 Gene:Usp20-33 / 36580 FlyBaseID:FBgn0033916 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_059110.2 Gene:USP18 / 11274 HGNCID:12616 Length:372 Species:Homo sapiens


Alignment Length:504 Identity:106/504 - (21%)
Similarity:166/504 - (32%) Gaps:184/504 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RREDSNASDSEGTDTAKG--SGTGLVGLQNIANTCYMNSALQALSNLPPMTHYFINCSDLVEYIA 119
            :.||||....:..:..:.  ...|||||.||..||.:||.:|.         :.:|.        
Human    30 KEEDSNMKREQPRERPRAWDYPHGLVGLHNIGQTCCLNSLIQV---------FVMNV-------- 77

  Fly   120 EQSARRCKPGGLAKSYRRLMQEIWQDVDDPKEFIAPRGILYGIRTVHPMFRGYQQHDTQEFLRCF 184
                          .:.|::          |....|||                           
Human    78 --------------DFTRIL----------KRITVPRG--------------------------- 91

  Fly   185 MDQLHEELTEQVSMLPQTQNQPQYQSLQQQQPSETDDENDDEAAPASLSHASESEYDTCESSM-- 247
            .|:....:..|:.:|           |::.|     |.......|..|::..:.    |...:  
Human    92 ADEQRRSVPFQMLLL-----------LEKMQ-----DSRQKAVRPLELAYCLQK----CNVPLFV 136

  Fly   248 SERSAEVLLKTEYFVTPCRTNGSNSGLPEGHSVQLQQAPLQHQQKNASSAEQKPIEAARSIISDV 312
            ...:|::.||.        .|.....:.:.|.|:..||                          :
Human   137 QHDAAQLYLKL--------WNLIKDQITDVHLVERLQA--------------------------L 167

  Fly   313 FDGKLLSSVQCLTCDRVSTREETFQDLSLPIPNRDFLNVLHQTHSLSVQSLNAAETSARTNEGWL 377
            :..::..|:.|:.|...|:|..:.  |:||:                  ||...::.        
Human   168 YTIRVKDSLICVDCAMESSRNSSM--LTLPL------------------SLFDVDSK-------- 204

  Fly   378 SWMWNMLRSWIYGPSVTLYDCMASFFSADELKGDNMYSCERCNKLRTGIKYSRVLTLPEVLCIHL 442
                         |..||.|.:..||...||...:...||.|.|...|.:..::..||:.|.|||
Human   205 -------------PLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHL 256

  Fly   443 KRFRNDLSYSSKISSDVYFP--LEGFDMRPYIHKDCKSEV---AIYNLSSVICHHGTVGGGHYTC 502
            .||....|.:.||...:|||  |:...:.|...:.|.:|.   ..|.|.:||.|.|....|||..
Human   257 MRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSGHYCV 321

  Fly   503 FARNTLNGKWYEFDDQFVTEVSSELVQSC-----------QAYVLFYHK 540
            :.||.::|||:.|:|..:..||.|.:| |           .||:|.|.|
Human   322 YIRNAVDGKWFCFNDSNICLVSWEDIQ-CTYGNPNYHWQETAYLLVYMK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp20-33NP_610943.2 UCH 79..538 CDD:278850 99/476 (21%)
Peptidase_C19 80..>204 CDD:271592 19/123 (15%)
Peptidase_C19R 307..538 CDD:239139 65/246 (26%)
DUSP 560..643 CDD:197831
DUSP 667..755 CDD:197831
USP18NP_059110.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..45 4/14 (29%)
Mediates interaction with IFNAR2. /evidence=ECO:0000269|PubMed:28165510 36..51 0/14 (0%)
Mediates interaction with STAT2. /evidence=ECO:0000269|PubMed:28165510 51..112 23/144 (16%)
UCH 55..367 CDD:306860 98/475 (21%)
Mediates interaction with STAT2 and necessary for the negative regulation of the type I IFN signaling pathway. /evidence=ECO:0000269|PubMed:28165510 303..312 4/8 (50%)
Mediates interaction with IFNAR2. /evidence=ECO:0000269|PubMed:28165510 313..372 20/58 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.