DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp20-33 and usp18

DIOPT Version :9

Sequence 1:NP_610943.2 Gene:Usp20-33 / 36580 FlyBaseID:FBgn0033916 Length:975 Species:Drosophila melanogaster
Sequence 2:XP_005164589.1 Gene:usp18 / 100334535 ZFINID:ZDB-GENE-100210-2 Length:337 Species:Danio rerio


Alignment Length:381 Identity:89/381 - (23%)
Similarity:148/381 - (38%) Gaps:84/381 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 RGYQQHDT-QEFLRCFMDQLHEELTEQVSMLPQTQNQPQYQSLQQQQPSETDDENDDEAAPASLS 233
            |||:.... .:.|.|.::.|.:..:....:|         ..|.:..||:..::::   .|..|.
Zfish    24 RGYEVRGLFNDGLSCCVNALLQSFSATTELL---------DILNKWNPSDGIEQSN---IPLQLR 76

  Fly   234 HASESEYDTCESSMSERSAEVLLKTEYFVTPCRTNGSNSGLPEGHSVQLQQAPLQHQQKNASSAE 298
            :...|..|...|:..:...:.|    |....||            ..|.....:.|...|.|..:
Zfish    77 NTLLSVRDPSHSAPHKGFLDCL----YRHAICR------------YTQQDADEIFHMILNLSLKQ 125

  Fly   299 QKPIEAARSIISDVFDGKLLSSVQCLTCDRVSTREETFQDLSLPIPNRDFLNVLHQTHSLSVQSL 363
            ....|.|:.|.| ::..::.:.|.|:.|..:.....::  .|||:       |:|:..:      
Zfish   126 MPDHELAQEIRS-LYTIEVETQVTCMDCTFIHRLPNSY--FSLPL-------VIHEGEN------ 174

  Fly   364 NAAETSARTNEGWLSWMWNMLRSWIYGPSVTLYDCMASFFSADELKGDNMYSCERCNKLRTGIKY 428
                                          ||..|:.|||...:|:....:.|:||.|.:.....
Zfish   175 ------------------------------TLESCIKSFFKKQKLEVSEKFFCDRCEKKQPCAYE 209

  Fly   429 SRVLTLPEVLCIHLKRFRNDLSYSSKISSDVYFP----LEGFDMRPYIHKDCKSEVAIYNLSSVI 489
            .::::||::||:|||||||:.....|:.|.|.||    :..|......:....|..|.|:|.:||
Zfish   210 QKLVSLPQILCVHLKRFRNEHGLIKKLDSKVTFPETLKISVFAAGQSENAASDSPQADYSLFAVI 274

  Fly   490 CHHGTVGGGHYTCFARNTLNGKWYEFDDQFVTEVSSELVQSC-----QAYVLFYHK 540
            .|.|:...||||.|.|.|.:..||..:|..|.:.:.:.||..     .||:|.|.|
Zfish   275 VHIGSAMFGHYTAFIRQTQDQMWYYANDSRVNQATWKDVQDTYKGRETAYLLLYRK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp20-33NP_610943.2 UCH 79..538 CDD:278850 87/377 (23%)
Peptidase_C19 80..>204 CDD:271592 7/34 (21%)
Peptidase_C19R 307..538 CDD:239139 62/239 (26%)
DUSP 560..643 CDD:197831
DUSP 667..755 CDD:197831
usp18XP_005164589.1 UCH 28..328 CDD:278850 84/373 (23%)
Peptidase_C19 97..329 CDD:239072 72/293 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.