DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8485 and SKS1

DIOPT Version :9

Sequence 1:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_015299.1 Gene:SKS1 / 856081 SGDID:S000005947 Length:502 Species:Saccharomyces cerevisiae


Alignment Length:465 Identity:104/465 - (22%)
Similarity:174/465 - (37%) Gaps:153/465 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGSGHFAVVKLARHVFTGAKVAVKVVDKTKLDD-------------VSKAHLFQ----------- 66
            :|||.:.:|.....:.|..:.|||.|.|:...|             |::..|.|           
Yeast    16 IGSGAYGLVFHVVDILTSREYAVKTVFKSSSMDEFYNKNGLNNNSQVARTTLLQTQLYHFFKSFQ 80

  Fly    67 ----------------------------EVRCMKLVQ-HPNVVRLYEVIDTQTKLYLVLELGDGG 102
                                        |:.....|| |.|:|::::|:::....::|::..| .
Yeast    81 KKLFLPSVDLDSILQLTENELNRLPHYREIAFQLRVQSHGNIVKIHQVLESSIATFIVMDYYD-R 144

  Fly   103 DLYDYIM--KH--DSGLSEELARKYFRQILRAITYCHQLHVVHRDLKPENVVFFEKLGLVKLTDF 163
            ||:..|:  ||  :.|:   |.:|.|.|:..|:.:||:|.:.|.|:|||||: .::.....|.||
Yeast   145 DLFTSIVDDKHFVNHGI---LIKKVFLQLCSALDHCHRLGIYHCDIKPENVL-LDRNDNAYLCDF 205

  Fly   164 GFS--NKFLPGQKLETFC-GSLAYSAPEILL---------------GDSYDAPAVDIWSLGVILY 210
            |.|  :|:|    ....| ||..|.|||.:|               ..|......||||||:||.
Yeast   206 GLSTKSKYL----APNVCVGSSYYMAPERILYCLNTTTNGIHVDECCSSLPTDTGDIWSLGIILI 266

  Fly   211 MLVCGQAPFEK------------ANDSETLTMIMDCKYTVPSHVSTDCRDLIASMLVRDPKKRAT 263
            .|.|.:.|:.|            |||:..|..|:.        :|.:...::..:|..:|..|..
Yeast   267 NLTCIRNPWLKAHQKEDNTFQHFANDNNVLKKILP--------ISDELFTVLTKILQLNPYTRID 323

  Fly   264 VEEIASSAWLKPIDEPDSTTS-------------TSEHFLPLVSREQ---LGEEDHAFIIQKMIN 312
            ::.:.|        |..|.||             :||.::..:.|.:   |.:..|....|:...
Yeast   324 MKTLMS--------EV
SSLTSFTREGPLSQVPILSSEVYMTHIIRNENLFLSDLSHFSADQEQQQ 380

  Fly   313 GNIASKEEILQALDKNKYNHITATYFLLAELRLRRRREELAQKQRLLNDASMKVGDASRKLVPEK 377
            .....::::.:...:.|...|              :.:|.||:|:...||.           ||.
Yeast   381 QQQQQQQQVQEQEQEQKQEQI--------------QNQEQAQQQQEEEDAE-----------PES 420

  Fly   378 PSPTEAQKGG 387
            ..|:.....|
Yeast   421 DIPSTYNSDG 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 82/333 (25%)
S_TKc 20..273 CDD:214567 82/333 (25%)
UBA_SNRK 296..338 CDD:270524 5/44 (11%)
SKS1NP_015299.1 PKc_like 9..331 CDD:419665 82/339 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.