DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8485 and KKQ8

DIOPT Version :9

Sequence 1:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_012753.2 Gene:KKQ8 / 853686 SGDID:S000001651 Length:724 Species:Saccharomyces cerevisiae


Alignment Length:311 Identity:70/311 - (22%)
Similarity:133/311 - (42%) Gaps:77/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGSGHFAVVKL------------------ARHVFTGAKVAVKVVDKTKLDDVSKAHLFQEVRCMK 72
            :|:|.:..|||                  :::::    .|||.:......|:.|.       |.|
Yeast   418 VGAGAYGEVKLCARLRNEKDSPPFETYHDSKYIY----YAVKELKPKPDSDLEKF-------CTK 471

  Fly    73 LVQH------------------PNVVRLYEVIDTQTKLYLVLELGDGGDLYDYIM---KHDSGLS 116
            :...                  ||::.::::::..:....|:|....||||..::   |....|.
Yeast   472 ITSEFIIGHSLSHYHKNGKKPAPNILNVFDILEDSSSFIEVMEFCPAGDLYGMLVGKSKLKGRLH 536

  Fly   117 EELARKYFRQILRAITYCHQLHVVHRDLKPENVVFFEKLGLVKLTDFGFSNKF-------LPGQK 174
            ...|..:.:|:|..:.:.|...:.|.||||||::|:.. ||:|:.|||.|:.|       :..||
Yeast   537 PLEADCFMKQLLHGVKFMHDHGIAHCDLKPENILFYPH-GLLKICDFGTSSVFQTAWERRVHAQK 600

  Fly   175 LETFCGSLAYSAPEILL-GDSYDAPAVDIWSLGVILYMLVCGQAPFEKANDSETLT--------- 229
              ...||..|.|||..: |:.||...:|.||.||:...::.|...::.|:..:.::         
Yeast   601 --GIIGSEPYVAPEEFVDGEYYDPRLIDCWSCGVVYITMILGHYLWKVASREKDMSYDEFYKEMQ 663

  Fly   230 ------MIMDCKYTVPSHVSTDCRDLIASMLVRDPKKRATVEEIASSAWLK 274
                  :..:.|: |.|.::|:.:..:..:...:|:||.:|.::....|:|
Yeast   664 RKNQFRVFEELKH-VNSELATNRKIALYRIFQWEPRKRISVGKLLDMQWMK 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 68/308 (22%)
S_TKc 20..273 CDD:214567 68/308 (22%)
UBA_SNRK 296..338 CDD:270524
KKQ8NP_012753.2 PKc_like 418..712 CDD:419665 68/308 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.