DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8485 and PRR2

DIOPT Version :9

Sequence 1:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_010067.1 Gene:PRR2 / 851312 SGDID:S000002373 Length:699 Species:Saccharomyces cerevisiae


Alignment Length:334 Identity:81/334 - (24%)
Similarity:142/334 - (42%) Gaps:52/334 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DLEETLGSGHFAVVKLARHVFTGAKVAVKVV-DKTKLDDVSK--AHLFQEVRCMKLVQHPNVVRL 82
            ||:..||.|....|||.:.|......|:|.. .|.|.:...|  .::..|......:::||:...
Yeast   362 DLDVVLGEGSGGKVKLVQRVLDNKVFALKEYRSKKKRESERKYIKNIISEYCIASTLKNPNICET 426

  Fly    83 YEVIDTQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFRQILRAITYCHQLHVVHRDLKPE 147
            .|::..:.|::.:||..: .||:..:|.......|...  .|:|::..:.|.|.:.:.|||||.:
Yeast   427 LEILYEKGKIFQILEYCE-YDLFSLVMSEKMHYEEICC--LFKQLINGVKYLHDIGLSHRDLKLD 488

  Fly   148 NVVFFEKLGLVKLTDFGFSNKF---LPGQKLET--FCGSLAYSAPEILLGDSYDAPAVDIWSLGV 207
            |.|...: |::||.|||.|:.|   |..|.:|.  ..||..|.:||:...:.||..|:|:||:|:
Yeast   489 NCVVTRR-GILKLIDFGASSVFHYPLSSQMIEANGIVGSDPYLSPEVFYFNEYDPRALDVWSVGI 552

  Fly   208 ILYMLVCGQAP--FEKANDSETLTM-----IMDCKYTVPSHVSTDCRD----------------- 248
            |.:.::..:.|  :.|..|.:....     :...|..|....:.|..:                 
Yeast   553 IFFCMITRRFPWKYPKVKDVQFKAFCSGRGVSSFKDLVTRPATDDSNNYDNDGYEEGVIDMGPNF 617

  Fly   249 -----------LIASMLVRDPKKRATVEEIASSAWLKPID--EPDSTTSTSEHFLPLVSREQLGE 300
                       ::..:|...|.:|.|:..|....|:|.|:  :.....|.:|..|.::::   |.
Yeast   618 ILHRLPEETHKIMRRILEVSPFRRITINGILQDGWIKEIETCQVVGAASPNEASLRIINK---GN 679

  Fly   301 EDHAFIIQK 309
            ..|..|.|:
Yeast   680 HIHTNIDQR 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 71/294 (24%)
S_TKc 20..273 CDD:214567 71/294 (24%)
UBA_SNRK 296..338 CDD:270524 4/14 (29%)
PRR2NP_010067.1 PKc_like 367..653 CDD:419665 69/289 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.