DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snrk and CIPK17

DIOPT Version :10

Sequence 1:NP_610942.2 Gene:Snrk / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_175260.1 Gene:CIPK17 / 841246 AraportID:AT1G48260 Length:432 Species:Arabidopsis thaliana


Alignment Length:90 Identity:19/90 - (21%)
Similarity:30/90 - (33%) Gaps:26/90 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 SYQTMSNL--SPNLQQQLNSLVQQQQQQQQQIGQQQQQQQQQATNPQLANLAGLDANAAALGSFQ 231
            :|..|||.  :..:.::|:||                     |.|..:....|.|   .|.|.|:
plant   403 TYDGMSNTESTDKVSKRLSSL---------------------ADNGSVGEYVGSD---KASGCFE 443

  Fly   232 SLAASFAAGNDNFQSLDDEDILSRH 256
            :....||....|....|.:..:..|
plant   444 NWIFQFAQLFKNHVGFDSDSYVDLH 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SnrkNP_610942.2 STKc_SNRK 16..273 CDD:270976 19/90 (21%)
UBA_SNRK 296..338 CDD:270524
CIPK17NP_175260.1 Protein Kinases, catalytic domain 10..265 CDD:473864
CIPK_C 307..418 CDD:213380 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.