DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8485 and CDPK2

DIOPT Version :9

Sequence 1:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_174807.1 Gene:CDPK2 / 840471 AraportID:AT1G35670 Length:495 Species:Arabidopsis thaliana


Alignment Length:377 Identity:123/377 - (32%)
Similarity:175/377 - (46%) Gaps:60/377 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YDLEETLGSGHFAVVKLARHVFTGAKVAVKVVDKTKL------DDVSKAHLFQEVRCM-KLVQHP 77
            |.|.:.||.|.|....|.....|.|..|.|.:.|.||      :||     ::|::.| .|.:||
plant    26 YLLGKKLGQGQFGTTYLCTEKSTSANYACKSIPKRKLVCREDYEDV-----WREIQIMHHLSEHP 85

  Fly    78 NVVRLYEVIDTQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFRQILRAITYCHQLHVVHR 142
            ||||:....:....:::|:|:.:||:|:|.|:. ....||..|.|..:.||..:..||.|.|:||
plant    86 NVVRIKGTYEDSVFVHIVMEVCEGGELFDRIVS-KGHFSEREAVKLIKTILGVVEACHSLGVMHR 149

  Fly   143 DLKPENVVFFEKLGLVKL--TDFGFSNKFLPGQKLETFCGSLAYSAPEILLGDSYDAPAVDIWSL 205
            ||||||.:|.......||  ||||.|..:.|||.|....||..|.|||:|  .....|.:|:||.
plant   150 DLKPENFLFDSPKDDAKLKATDFGLSVFYKPGQYLYDVVGSPYYVAPEVL--KKCYGPEIDVWSA 212

  Fly   206 GVILYMLVCGQAPFEKANDSETLTMIMDCKYTVPSH----VSTDCRDLIASMLVRDPKKRATVEE 266
            |||||:|:.|..||....:|.....|:..|....|.    :|...:|||..||.|.||||.:..|
plant   213 GVILYILLSGVPPFWAETESGIFRQILQGKLDFKSDPWPTISEAAKDLIYKMLERSPKKRISAHE 277

  Fly   267 IASSAWL--------KPIDEPDSTTSTSEHFLPL---------VSREQLGEEDHAFIIQKMINGN 314
            .....|:        ||:|  .:..|..:.|..:         |..|:|.||:            
plant   278 ALCHPWI
VDEQAAPDKPLD--PAVLSRLKQFSQMNKIKKMALRVIAERLSEEE------------ 328

  Fly   315 IASKEEILQALDKNKYNHITATYFLLAELR--LRRRREELAQKQ-RLLNDAS 363
            |...:|:.:.:|.:....||     ..||:  |:|...||.:.: :.|.||:
plant   329 IGGLKELFKMIDTDNSGTIT-----FEELKAGLKRVGSELMESEIKSLMDAA 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 98/265 (37%)
S_TKc 20..273 CDD:214567 98/265 (37%)
UBA_SNRK 296..338 CDD:270524 9/41 (22%)
CDPK2NP_174807.1 STKc_CAMK 25..283 CDD:270687 98/264 (37%)
Pkinase 26..284 CDD:278497 98/265 (37%)
PTZ00184 320..462 CDD:185504 18/73 (25%)
EFh 332..391 CDD:238008 13/49 (27%)
EFh 404..463 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.