DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8485 and SnRK1.3

DIOPT Version :9

Sequence 1:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_198760.1 Gene:SnRK1.3 / 833940 AraportID:AT5G39440 Length:494 Species:Arabidopsis thaliana


Alignment Length:336 Identity:124/336 - (36%)
Similarity:186/336 - (55%) Gaps:32/336 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YDLEETLGSGHFAVVKLARHVFTGAKVAVKVVDKTKLDDVS-KAHLFQEVRCMKLVQHPNVVRLY 83
            |.:.:|||.|.||.||||.||.||.|||:|:::::|:.::. :..:.:|::.::.:.||:::|.|
plant    19 YRIGKTLGHGSFAKVKLALHVATGHKVAIKILNRSKIKNMGIEIKVQREIKILRFLMHPHIIRQY 83

  Fly    84 EVIDTQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFRQILRAITYCHQLHVVHRDLKPEN 148
            |||:|...:|:|:|....|:|:|||::... |.|:.||..|:||:..:.|||:..:|||||||||
plant    84 EVIETPNDIYVVMEYVKSGELFDYIVEKGK-LQEDEARHLFQQIISGVEYCHRNMIVHRDLKPEN 147

  Fly   149 VVFFEKLGLVKLTDFGFSNKFLPGQKLETFCGSLAYSAPEILLGDSYDAPAVDIWSLGVILYMLV 213
            |:...:.. :|:.|||.||....|..|:|.|||..|:|||::.|..| .|.|||||.|||||.|:
plant   148 VLLDSQCN-IKIVDFGLSNVMHDGHFLKTSCGSPNYAAPEVISGKPY-GPDVDIWSCGVILYALL 210

  Fly   214 CGQAPFEKANDSETLTMIMDCKYTVPSHVSTDCRDLIASMLVRDPKKRATVEEIASSAW------ 272
            ||..||:..|.......|....||:|:|:|...||||..||:.||..|.::.||....|      
plant   211 CGTLPFDDENIPNVFEKIKRGMYTLPNHLSHFARDLIPRMLMVDPTMRISITEIRQHPWFNNHLP 275

  Fly   273 ----LKPIDEPDSTTSTSEHFLPLVSREQLGEEDHAFIIQKMINGNIASKEEILQALDKNKYNHI 333
                :.|:|..|......|.                 |||.::|... .:..::.:|.....|..
plant   276 LYLSIPPLDTIDQAKKIEEE-----------------IIQNVVNIGF-DRNHVVDSLANRIQNEA 322

  Fly   334 TATYFLLAELR 344
            |..|.|:.:.|
plant   323 TVAYHLILDNR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 110/263 (42%)
S_TKc 20..273 CDD:214567 110/263 (42%)
UBA_SNRK 296..338 CDD:270524 7/41 (17%)
SnRK1.3NP_198760.1 STKc_AMPK_alpha 16..270 CDD:270981 109/253 (43%)
UBA_SnRK1_plant 292..332 CDD:270520 10/57 (18%)
AMPKA_C 388..491 CDD:213378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24343
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.