DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8485 and CDPK6

DIOPT Version :9

Sequence 1:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_194096.1 Gene:CDPK6 / 828465 AraportID:AT4G23650 Length:529 Species:Arabidopsis thaliana


Alignment Length:408 Identity:128/408 - (31%)
Similarity:190/408 - (46%) Gaps:69/408 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TLETQPVGGVSDGKIAG--------LYDLEETLGSGHFAVVKLARHVFTGAKVAVKVVDKTKL-- 56
            |..||     .:|:|.|        .|:....||.|.|.|..|..|..|..:||.|.:...:|  
plant    57 TTSTQ-----QNGRILGRPMEEVRRTYEFGRELGRGQFGVTYLVTHKETKQQVACKSIPTRRLVH 116

  Fly    57 -DDVSKAHLFQEVRCM-KLVQHPNVVRLYEVIDTQTKLYLVLELGDGGDLYDYIMKHDSGL-SEE 118
             ||:....  :||:.| .|..|.|:|.|....:.:..:.|::||.:||:|:|.|:  ..|| ||.
plant   117 KDDIEDVR--REVQIMHHLSGHRNIVDLKGAYEDRHSVNLIMELCEGGELFDRII--SKGLYSER 177

  Fly   119 LARKYFRQILRAITYCHQLHVVHRDLKPENVVFFEK--LGLVKLTDFGFSNKFLPGQKLETFCGS 181
            .|....||::..:..||.:.|:||||||||.:|..|  ...:|.||||.|..|.||.|.:...||
plant   178 AAADLCRQMVMVVHSCHSMGVMHRDLKPENFLFLSKDENSPLKATDFGLSVFFKPGDKFKDLVGS 242

  Fly   182 LAYSAPEILLGDSYDAPAVDIWSLGVILYMLVCGQAPFEKANDSETLTMIMDCKYTVPSH----V 242
            ..|.|||:|..:.  .|..||||.|||||:|:.|..||...|::.....|:..:....:.    :
plant   243 AYYVAPEVLKRNY--GPEADIWSAGVILYILLSGVPPFWGENETGIFDAILQGQLDFSADPWPAL 305

  Fly   243 STDCRDLIASMLVRDPKKRATVEEIASSAWL--------KPIDEPDSTTSTSEHFLPL------- 292
            |...:||:..||..|||.|.|..|:.:..|:        ||:|  ::..|..:.|..:       
plant   306 SDGAKDLVRKMLKYDPKDRLTAAEVLNHPWIREDGEASDKPLD--NAVLSRMKQFRAMNKLKKMA 368

  Fly   293 --VSREQLGEEDHAFIIQKMINGNIASKEEILQALDKNKYNHITATYFLLAELR--LRRRREELA 353
              |..|.|.||:            |...:|:.::||.:....:|     |.|||  |.:...:::
plant   369 LKVIAENLSEEE------------IIGLKEMFKSLDTDNNGIVT-----LEELRTGLPKLGSKIS 416

  Fly   354 QKQ-RLLNDASMKVGDAS 370
            :.: |.|.:|:...||.|
plant   417 EAEIRQLMEAADMDGDGS 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 97/275 (35%)
S_TKc 20..273 CDD:214567 95/263 (36%)
UBA_SNRK 296..338 CDD:270524 9/41 (22%)
CDPK6NP_194096.1 STKc_CAMK 78..335 CDD:270687 95/262 (36%)
PTZ00184 372..515 CDD:185504 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.