DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8485 and CPK15

DIOPT Version :9

Sequence 1:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_001190794.1 Gene:CPK15 / 828283 AraportID:AT4G21940 Length:561 Species:Arabidopsis thaliana


Alignment Length:402 Identity:116/402 - (28%)
Similarity:182/402 - (45%) Gaps:64/402 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ETQPVGGVSDGKIAGLYDLEETLGSGHFAVVKLARHVFTGAKVAVKVVDKTKL------DDVSKA 62
            ||:.:.|....:|..||.|.:.||.|.|.:....:...||...|.|.:.|.||      |||.: 
plant    86 ETETILGKPFEEIRKLYTLGKELGRGQFGITYTCKENSTGNTYACKSILKRKLTRKQDIDDVKR- 149

  Fly    63 HLFQEVRCMK-LVQHPNVVRLYEVIDTQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFRQ 126
                |::.|: |....|:|.:....:.:..::||:||..|.:|:|.|:. ....||:.|....|.
plant   150 ----EIQIMQYLSGQENIVEIKGAYEDRQSIHLVMELCGGSELFDRIIA-QGHYSEKAAAGVIRS 209

  Fly   127 ILRAITYCHQLHVVHRDLKPENVVF--FEKLGLVKLTDFGFSNKFLPGQKLETFCGSLAYSAPEI 189
            :|..:..||.:.|:||||||||.:.  .::..::|.||||.|.....|:......||..|.|||:
plant   210 VLNVVQICHFMGVIHRDLKPENFLLASTDENAMLKATDFGLSVFIEEGKVYRDIVGSAYYVAPEV 274

  Fly   190 LLGDSYDAPAVDIWSLGVILYMLVCGQAPF----EKANDSETLTMIMDCKYTVPSHVSTDCRDLI 250
             |..|| ...:||||.|:|||:|:||..||    ||...:|.:...:|........:|...:||:
plant   275 -LRRSY-GKEIDIWSAGIILYILLCGVPPFWSETEKGIFNEIIKGEIDFDSQPWPSISESAKDLV 337

  Fly   251 ASMLVRDPKKRATVEEIASSAWL-------KPIDEPDSTTSTSEHFLPL---------VSREQLG 299
            ..:|.:|||:|.:..:.....|:       ||||  .:..|..:.|..:         |..|.|.
plant   338 RKLLTKDPKQRISAAQALEHPWIRGGEAPDKPID--SAVLSRMKQFRAMNKLKKLALKVIAESLS 400

  Fly   300 EED----------------HAFIIQKMING--NIASK------EEILQALDKNKYNHITATYFLL 340
            ||:                .....:::.||  .:.||      :::::|.|.:....|....|:.
plant   401 EEEIKGLKTMFANMDTDKSGTITYEELKNGLAKLGSKLTEAEVKQLMEAADVDGNGTIDYIEFIS 465

  Fly   341 AEL-RLRRRREE 351
            |.: |.|..|:|
plant   466 ATMHRYRFDRDE 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 88/269 (33%)
S_TKc 20..273 CDD:214567 86/265 (32%)
UBA_SNRK 296..338 CDD:270524 11/65 (17%)
CPK15NP_001190794.1 S_TKc 102..360 CDD:214567 86/265 (32%)
STKc_CAMK 102..359 CDD:270687 86/264 (33%)
PTZ00184 395..540 CDD:185504 17/83 (20%)
EFh 407..466 CDD:238008 8/58 (14%)
EFh 478..539 CDD:238008 116/402 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.