DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8485 and CPK23

DIOPT Version :9

Sequence 1:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_001190672.1 Gene:CPK23 / 825809 AraportID:AT4G04740 Length:533 Species:Arabidopsis thaliana


Alignment Length:466 Identity:135/466 - (28%)
Similarity:198/466 - (42%) Gaps:108/466 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IAGLYDLEETLGSGHFAVVKLARHVFTGAKVAVKVVDKTKL-DDVSKAHLFQEVRCMK-LVQHPN 78
            |...|.|...||.|...:..:.:.:.||...|.|.:.|.|| .::.:..:..|::.|: |...||
plant    65 IRKFYSLGRELGRGGLGITYMCKEIGTGNIYACKSILKRKLISELGREDVKTEIQIMQHLSGQPN 129

  Fly    79 VVRLYEVIDTQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFRQILRAITYCHQLHVVHRD 143
            ||.:....:.:..::||:||..||:|:|.|:. ....||..|....:.|:..:..||...|:|||
plant   130 VVEIKGSYEDRHSVHLVMELCAGGELFDRIIA-QGHYSERAAAGTIKSIVDVVQICHLNGVIHRD 193

  Fly   144 LKPENVVFF--EKLGLVKLTDFGFSNKFLPGQKLETFCGSLAYSAPEILLGDSYDAPAVDIWSLG 206
            |||||.:|.  |:..::|:||||.|.....|:..:...||..|.|||: |..|| ...:||||.|
plant   194 LKPENFLFSSKEENAMLKVTDFGLSAFIEEGKIYKDVVGSPYYVAPEV-LRQSY-GKEIDIWSAG 256

  Fly   207 VILYMLVCGQAPFEKANDSETLTMIMDCKYTV-----PSHVSTDCRDLIASMLVRDPKKRATVEE 266
            ||||:|:||..||...|:......|:.||...     || :|...:||:..||..|||:|.|..:
plant   257 VILYILLCGVPPFWADNEEGVFVEILKCKIDFVREPWPS-ISDSAKDLVEKMLTEDPKRRITAAQ 320

  Fly   267 IASSAWLKPIDEP----DSTT-STSEHFLPL---------VSREQLGEEDHAFI----------- 306
            :....|:|..:.|    |||. |..:.|..:         ||...|.||:...:           
plant   321 VLEHPWIKGGEAPEKPIDSTVLSRMKQFRAMNKLKKLALKVSAVSLSEEEIKGLKTLFANMDTNR 385

  Fly   307 ------------------------IQKMI-------NGNIASKEEI------------------L 322
                                    :|:::       ||.|...|.|                  .
plant   386 SGTITYEQLQTGLSRLRSRLSETEVQQLVEASDVDGNGTIDYYEFISATMHRYKLHHDEHVHKAF 450

  Fly   323 QALDKNKYNHITATYFLLAELRLRRRREEL--AQKQRLLND-ASMK----VGDASRKLVPEKPSP 380
            |.|||:|..|||              |:||  |.|:..:.| ||:|    ..|....|.|.:...
plant   451 QHLDKDKNGHIT--------------RDELESAMKEYGMGDEASIKEVISEVDTDNALSPVEIMR 501

  Fly   381 TEAQKGGVPIS 391
            ..|.:.|||::
plant   502 EVALEIGVPVN 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 92/265 (35%)
S_TKc 20..273 CDD:214567 91/261 (35%)
UBA_SNRK 296..338 CDD:270524 17/101 (17%)
CPK23NP_001190672.1 STKc_CAMK 82..326 CDD:270687 86/247 (35%)
S_TKc 84..327 CDD:214567 86/246 (35%)
EF-hand_7 374..433 CDD:290234 6/58 (10%)
EFh 374..433 CDD:238008 6/58 (10%)
EFh 445..>492 CDD:238008 18/60 (30%)
EF-hand_7 446..>492 CDD:290234 18/59 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.