DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8485 and CPK21

DIOPT Version :9

Sequence 1:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_001319867.1 Gene:CPK21 / 825807 AraportID:AT4G04720 Length:531 Species:Arabidopsis thaliana


Alignment Length:391 Identity:119/391 - (30%)
Similarity:174/391 - (44%) Gaps:57/391 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TLETQPVGGVSD-----GK----IAGLYDLEETLGSGHFAVVKLARHVFTGAKVAVKVVDKTKL- 56
            |..:.|| .|.|     ||    |...|.|.:.||.|.|.:..:.:.:.||...|.|.:.|.|| 
plant    54 TPSSNPV-SVRDPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCKEIGTGNTYACKSILKRKLI 117

  Fly    57 -----DDVSKAHLFQEVRCMK-LVQHPNVVRLYEVIDTQTKLYLVLELGDGGDLYDYIMKHDSGL 115
                 :||.:     |::.|: |...||:|.:....:.:..::||:||..||:|:|.|:. ....
plant   118 SKQDKEDVKR-----EIQIMQYLSGQPNIVEIKGAYEDRQSIHLVMELCAGGELFDRIIA-QGHY 176

  Fly   116 SEELARKYFRQILRAITYCHQLHVVHRDLKPENVVFF--EKLGLVKLTDFGFSNKFLPGQKLETF 178
            ||..|....|.|:..:..||.:.||||||||||.:..  |:..::|.||||.|.....|:.....
plant   177 SERAAAGIIRSIVNVVQICHFMGVVHRDLKPENFLLSSKEENAMLKATDFGLSVFIEEGKVYRDI 241

  Fly   179 CGSLAYSAPEILLGDSYDAPAVDIWSLGVILYMLVCGQAPFEKANDSETLTMIMDCKYTVPSH-- 241
            .||..|.|||: |..|| ...:||||.|||||:|:.|..||...|:......::..:....|.  
plant   242 VGSAYYVAPEV-LRRSY-GKEIDIWSAGVILYILLSGVPPFWAENEKGIFDEVIKGEIDFVSEPW 304

  Fly   242 --VSTDCRDLIASMLVRDPKKRATVEEIASSAWLKPIDEPD-----STTSTSEHFLPL------- 292
              :|...:||:..||.:|||:|.|..::....|:|..:.||     :..|..:.|..:       
plant   305 PSISESAKDLVRKMLTKDPKRRITAAQVLEHPWIKGGEAPDKPIDSAVLSRMKQFRAMNKLKKLA 369

  Fly   293 --VSREQLGEEDHAFIIQKMINGNIASKEEILQALDKNKYNHITATYFLLAELRLRRRREELAQK 355
              |..|.|.||:            |...:.:...:|.:|...||.........||..|..|...|
plant   370 LKVIAESLSEEE------------IKGLKTMFANIDTDKSGTITYEELKTGLTRLGSRLSETEVK 422

  Fly   356 Q 356
            |
plant   423 Q 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 90/269 (33%)
S_TKc 20..273 CDD:214567 89/265 (34%)
UBA_SNRK 296..338 CDD:270524 9/41 (22%)
CPK21NP_001319867.1 STKc_CAMK 79..337 CDD:270687 89/265 (34%)
PTZ00184 373..518 CDD:185504 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.