DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8485 and CPK31

DIOPT Version :9

Sequence 1:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_680596.2 Gene:CPK31 / 825804 AraportID:AT4G04695 Length:484 Species:Arabidopsis thaliana


Alignment Length:376 Identity:115/376 - (30%)
Similarity:177/376 - (47%) Gaps:55/376 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VSDGKIAGLYDLEETLGSGHFAVVKLARHVFTGAKVAVKVVDKTKL-----DDVSKAHLFQEVRC 70
            |..||:   |.|.:.||.|.|.:.:......:|...|.|.:.||.|     ::..|    :|:|.
plant    22 VDIGKV---YILGDELGQGQFGITRKCVEKTSGKTYACKTILKTNLKSREDEEAVK----REIRI 79

  Fly    71 MK-LVQHPNVVRLYEVIDTQTKLYLVLELGDGGDLY---DYIMKHDSGLSEELARKYFRQILRAI 131
            || |...||:|...:..:.:..:::|:|...||:|:   :.:.|.....||:.|.:..|.|:..:
plant    80 MKHLSGEPNIVEFKKAYEDRDSVHIVMEYCGGGELFKKIEALSKDGKSYSEKEAVEIIRPIVNVV 144

  Fly   132 TYCHQLHVVHRDLKPENVVF--FEKLGLVKLTDFGFSNKFLPGQKLETFCGSLAYSAPEILLGDS 194
            ..||.:.|:.|||||||.:.  .:|...||..|||.|.....|:....|.||..|.|||:|.| .
plant   145 KNCHYMGVMLRDLKPENFLLSSTDKNATVKAIDFGCSVFIEEGEVHRKFAGSAYYIAPEVLQG-K 208

  Fly   195 YDAPAVDIWSLGVILYMLVCGQAPFEKANDSETLTMIMDCKYTVPSH----VSTDCRDLIASMLV 255
            |...| ||||.|:|||:|:||:.||....:::..:.|...|..|.|.    :....:.|:..||.
plant   209 YGKEA-DIWSAGIILYILLCGKPPFVTEPEAQMFSEIKSAKIDVDSESWKFIDVKAKHLVNRMLN 272

  Fly   256 RDPKKRATVEEIASSAWL-------KPIDEPDSTTSTSEHFLPLVSREQLGEEDHAFIIQKMING 313
            |:||:|.:..|:....|:       ||||  ....|..:.|..:...::        :..|:|..
plant   273 RNPKERISAAEVLGHPWMKDGEASDKPID--GVVLSRLKQFRDMNKLKK--------VALKVIAA 327

  Fly   314 NIASKEEI--LQAL----DKNKYNHITATYFLLAELR--LRRRREELAQKQ 356
            |: |:|||  |:.|    |.:|...||     |.||:  |.|....|::.:
plant   328 NL-SEEEIKGLKTLFTNIDTDKSGTIT-----LEELKTGLTRLGSNLSKTE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 86/271 (32%)
S_TKc 20..273 CDD:214567 86/267 (32%)
UBA_SNRK 296..338 CDD:270524 13/47 (28%)
CPK31NP_680596.2 STKc_CAMK 27..289 CDD:270687 86/270 (32%)
S_TKc 28..290 CDD:214567 86/267 (32%)
PTZ00184 325..470 CDD:185504 18/54 (33%)
EFh 337..396 CDD:238008 12/41 (29%)
EFh 412..469 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.