DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8485 and CG17698

DIOPT Version :9

Sequence 1:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_001036633.2 Gene:CG17698 / 4379919 FlyBaseID:FBgn0040056 Length:694 Species:Drosophila melanogaster


Alignment Length:338 Identity:93/338 - (27%)
Similarity:151/338 - (44%) Gaps:77/338 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YDLEETLGSGHFAVVKLARHVFTGAKVAVKVVDKTKLDDVSKAHL---------------FQEVR 69
            |.|.|.:|.|.:.:||||.........|:|::.|.:|  :.:|.|               ::|:.
  Fly   283 YRLMEQIGQGSYGLVKLAYSEEDSTHYAMKILSKKRL--LRQAGLMRRGPRKATSPLDRVYREIA 345

  Fly    70 CMKLVQHPNVVRLYEVID--TQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFRQILRAIT 132
            .:|.:.|||||:|.||:|  .:..||:|.||...|::..  :..|:.|||:.|...||:.|..:.
  Fly   346 VLKKLDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVLR--IPTDNPLSEKRAWSIFRESLLGLE 408

  Fly   133 Y------------------CHQLHVVHRDLKPENVVFFEKLGLVKLTDFGFSNKFLPGQKL---E 176
            |                  .|...::|.|:||.|::..| .|.||:.|.|..|:||.....   .
  Fly   409 YYTMLSSSAISLKRIFVYTVHHQKIIHADIKPGNLLLTE-FGHVKIADLGVCNEFLGDDATISNG 472

  Fly   177 TFCGSLAYSAPEILL--GDSYDAPAVDIWSLGVILYMLVCGQAPF---------EKANDSETLTM 230
            :..|:.|:.|||.|:  .:.|...|.|:|:||..||.|:.|..||         ||......   
  Fly   473 STAGTPAFRAPETLIPGQNEYCGRAADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQDSV--- 534

  Fly   231 IMDCKYTVPSHVSTDCRDLIASMLVRDPKKRATVEEIASSAWLKPIDEPDSTTSTSEHFLPLVSR 295
                |:.....|:.:.:..|..||.::|.:|.|:.::.:|.|:         ||..::.||.   
  Fly   535 ----KFPENHKVTENLKSCIVQMLEKNPTQRITIPQLKTSKWV---------TSDGDYPLPT--- 583

  Fly   296 EQLGEEDHAFIIQ 308
                ||::..::|
  Fly   584 ----EEENCCLVQ 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 85/301 (28%)
S_TKc 20..273 CDD:214567 85/301 (28%)
UBA_SNRK 296..338 CDD:270524 3/13 (23%)
CG17698NP_001036633.2 S_TKc 283..573 CDD:214567 85/301 (28%)
STKc_CAMKK 288..574 CDD:271020 83/306 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.