DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8485 and CG10177

DIOPT Version :9

Sequence 1:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster


Alignment Length:271 Identity:88/271 - (32%)
Similarity:134/271 - (49%) Gaps:29/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YDLEETLGSGHFAVVKLARH-----VFTG------AKVAVKVVDK-TKLDDVSKAHLFQEVRCMK 72
            :||.|.: ..:...::...|     ::.|      .|..||:|:| |:.:|....::..|| ..:
  Fly   139 HDLPEAI-QLYIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQSNDRGDTYMEAEV-LRQ 201

  Fly    73 LVQHPNVVRLYEVIDTQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFRQILRAITYCHQL 137
            |..|||::.|...::.:..:|.|||..| .::...|.|... |||..||...|..:.|:.:.|||
  Fly   202 LQSHPNIIELMYTVEDERYMYTVLEHLD-CNMQKVIQKRGI-LSEADARSVMRCTVSALAHMHQL 264

  Fly   138 HVVHRDLKPENVVFFEKLG-----LVKLTDFGFSNKFLPGQKLETFCGSLAYSAPEILLGDSYDA 197
            .|:|||:||||::.....|     :||:.:|..:. :..|.||...||:..|.|||::....||.
  Fly   265 QVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLAT-YYRGSKLYVRCGTPCYMAPEMIAMSGYDY 328

  Fly   198 PAVDIWSLGVILYMLVCGQAPFEKA--NDSETLTMIMDCKYTVP----SHVSTDCRDLIASMLVR 256
             .||.|||||.|:.::||:.||..|  |..|....||....|.|    |.:|.:...||..:||.
  Fly   329 -QVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVS 392

  Fly   257 DPKKRATVEEI 267
            ||..|..:.|:
  Fly   393 DPSYRVPIAEL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 88/271 (32%)
S_TKc 20..273 CDD:214567 88/271 (32%)
UBA_SNRK 296..338 CDD:270524
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 84/245 (34%)
PKc_like 164..403 CDD:304357 83/243 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.