DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8485 and CG9222

DIOPT Version :9

Sequence 1:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster


Alignment Length:262 Identity:89/262 - (33%)
Similarity:147/262 - (56%) Gaps:12/262 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LEETLGSGHFAVVKLARHVFTGAKVAVKVVDKTKL-DDVSKAHLFQEVRCMKLVQHPNVVRLYEV 85
            |.:.:|:|::|.||:......|.:||||::.|.|. .:.::..|.:|:..:|.:.|.|::..|:.
  Fly    78 LGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQS 142

  Fly    86 IDTQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFRQILRAITYCHQLHVVHRDLKPENVV 150
            |:|..::||:::|.:.|.|.||: :....|.|..:|..|:|::.|:.|.|...|||||:|.||::
  Fly   143 IETSHRVYLIMQLAENGTLLDYV-RERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCENLL 206

  Fly   151 FFEKLGLVKLTDFGFSNK---FLPGQKL--ETFCGSLAYSAPEILLGDSYDAPAVDIWSLGVILY 210
            ..|...| ||.||||:.|   ....|.:  :|||||.||::||||.|.:||....|||:.||:.|
  Fly   207 LDENWNL-KLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVCY 270

  Fly   211 MLVCGQAPFEKANDSETLTMI-MDCKYTVPSHVSTDCRDLIASMLVRDPKK-RATVEEIASSAWL 273
            .:|.|:.|::.:|....|..| ....:......|::|:.:|..:|.  |.| |..:.::....|.
  Fly   271 AMVFGRLPYDGSNVHILLKRINQSLVFPKSPSASSECKHMIMHILA--PVKIRYNIPQVKEDPWY 333

  Fly   274 KP 275
            .|
  Fly   334 SP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 87/258 (34%)
S_TKc 20..273 CDD:214567 87/258 (34%)
UBA_SNRK 296..338 CDD:270524
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 87/258 (34%)
S_TKc 78..332 CDD:214567 87/257 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24343
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.