DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8485 and ran1

DIOPT Version :9

Sequence 1:NP_610942.2 Gene:CG8485 / 36579 FlyBaseID:FBgn0033915 Length:860 Species:Drosophila melanogaster
Sequence 2:NP_595690.1 Gene:ran1 / 2540580 PomBaseID:SPBC19C2.05 Length:470 Species:Schizosaccharomyces pombe


Alignment Length:343 Identity:90/343 - (26%)
Similarity:152/343 - (44%) Gaps:86/343 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGSGHFAVVKLARHVFTGAKVAVKVVDKTKLDDVSKAHLFQEVRC-MKLVQHPNVVRLYEVIDTQ 89
            :|:|.:.||..|..::.|...|||.:.|..|::..|....:|:.. .::..||.::.|:.|::|:
pombe    24 IGAGAYGVVYKAEDIYDGTLYAVKALCKDGLNEKQKKLQARELALHARVSSHPYIITLHRVLETE 88

  Fly    90 TKLYLVLELGDGGDLYDYI--MKHDSGLSEELARKYFRQILRAITYCHQLHVVHRDLKPENVVFF 152
            ..:|:||:....|||:.||  .|...| :..|.:..|.|::.|:.:||.:.:.||||||||::..
pombe    89 DAIYVVLQYCPNGDLFTYITEKKVYQG-NSHLIKTVFLQLISAVEHCHSVGIYHRDLKPENIMVG 152

  Fly   153 EKLGLVKLTDFG------FSNKFLPGQKLETFCGSLAYSAPEI--------LLGD---------- 193
            ..:..|.|.|||      :|:.|        .||||.|.:||.        .|.|          
pombe   153 NDVNTVYLADFGLATTEPYSSDF--------GCGSLFYMSPECQREVKKLSSLSDMLPVTPEPIE 209

  Fly   194 ----SYDAPAVDIWSLGVILYMLVCGQAPFEKA------------NDSETLTMIMDCKYTVPSHV 242
                |:.....|:|:||:||..|.|.:.|:::|            ::..||..|:.        :
pombe   210 SQSSSFATAPNDVWALGIILINLCCKRNPWKRACSQTDGTYRSYVHNPSTLLSILP--------I 266

  Fly   243 STDCRDLIASMLVRDPKKRATVEEIAS--------SAWLKPIDEPDSTTSTSEHFLPLVSREQLG 299
            |.:...|:..:..|:||.|.|:.|:::        :..|:|              .||||...|.
pombe   267 SRELNSLLNRIFDRNPKTRITLPELSTLV
SNCKNLTRRLRP--------------APLVSSRYLA 317

  Fly   300 ----EEDHAFIIQKMING 313
                ::.....:|:.|.|
pombe   318 YQQQQQQQQMNLQQGIQG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8485NP_610942.2 STKc_SNRK 16..273 CDD:270976 80/297 (27%)
S_TKc 20..273 CDD:214567 80/297 (27%)
UBA_SNRK 296..338 CDD:270524 4/22 (18%)
ran1NP_595690.1 STKc_Pat1_like 17..295 CDD:270895 80/287 (28%)
S_TKc 19..291 CDD:214567 79/283 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.