DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opa1 and DRP4A

DIOPT Version :9

Sequence 1:NP_725369.1 Gene:Opa1 / 36578 FlyBaseID:FBgn0261276 Length:972 Species:Drosophila melanogaster
Sequence 2:NP_176253.1 Gene:DRP4A / 842348 AraportID:AT1G60530 Length:301 Species:Arabidopsis thaliana


Alignment Length:281 Identity:79/281 - (28%)
Similarity:130/281 - (46%) Gaps:32/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 IKKSLIDMYSE----VLDELSGYDTGYTMAD--HLPRVVVVGDQSSGKTSVLESIAKARIFPRGS 329
            |:..::..|::    :||.:........|.:  .||.:||||||||||:|||||:|...: |||.
plant    28 IEAPIVSSYNDRIRPLLDTVDRLRNLNVMREGIQLPTIVVVGDQSSGKSSVLESLAGINL-PRGQ 91

  Fly   330 GEMMTRAPVKVTLAEGPYHVAQFRDSDREYDLTKESDLQDLRRDVEFRMKA------SVRG-GKT 387
            | :.||.|:.:.|.         |.|..|.::..|...:.:..|.|...:|      .:.| |:.
plant    92 G-ICTRVPLVMRLQ---------RSSSPEPEIWLEYSDKVVPTDEEHVAEAICAATDVIAGTGEG 146

  Fly   388 VSNEVIAMTVKGPGLQRMVLVDLPGIISTMTVDMASDTKDSIHQMTKHYMSNPNAIILCIQDGSV 452
            ||:..:.::||...:..:.:||||||..........:..:.|.:|...|:....:|||.:...:|
plant   147 VSDTPLTLSVKKNNVPDLTMVDLPGITRVPVNGQPENIYEQISRMIMKYIEPQESIILNVLSATV 211

  Fly   453 DAERSNVTDLVMQCDPLGRRTIFVLTKVDLAEELADPDRIRKILSGKLFPMKALGYYAVVTGRGR 517
            |........:..|.|..|.||:.|:||.|:|.|    ..::|:.:..:  ...|||..|....| 
plant   212 DFTTCESIRMSRQVDKTGERTLAVVTKADMAPE----GLLQKVTADDV--SIGLGYICVRNRIG- 269

  Fly   518 KDDSIDAIRQYEEDFFKNSKL 538
             :::.:..|..|:..|:...|
plant   270 -EETYEEARVQEDLLFRTHPL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Opa1NP_725369.1 DLP_1 298..572 CDD:206738 74/248 (30%)
DRP4ANP_176253.1 DLP_1 60..300 CDD:206738 74/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.