DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8468 and MCH5

DIOPT Version :9

Sequence 1:NP_610940.1 Gene:CG8468 / 36577 FlyBaseID:FBgn0033913 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_014951.4 Gene:MCH5 / 854483 SGDID:S000005833 Length:521 Species:Saccharomyces cerevisiae


Alignment Length:291 Identity:73/291 - (25%)
Similarity:103/291 - (35%) Gaps:108/291 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TKSQDELASKGL-VSKQP---ENIK------EENEGEEEIEEAAVVVPPDSGW-AWVVMVASFLC 59
            ||.:   .:||. :..||   ||..      :|.:..||||..     |:.|: ||||....|| 
Yeast    60 TKKE---VNKGTDIESQPHWGENTSSTHDSDKEEDSNEEIESF-----PEGGFKAWVVTFGCFL- 115

  Fly    60 CTVIDGIVFCSGL----------IQEQLMAEFGVSK--------AYVAFVSSLLSGCYLMAGPFV 106
                 |::.|.||          :|:..::...||.        .:|...|.::||.|.      
Yeast   116 -----GLIACFGLLNSTGVIESHLQDNQLSSESVSTIGWLFSLFLFVCSASCIISGTYF------ 169

  Fly   107 SAMANRFGFRPVTITGAIFAAICFGLSYFATSVEY--LFLIYGVLGGIGFCMVYIPAVVIIGFYF 169
                :|.|||.:.|.|.:|...  ||...|.|.:|  ..|.:.::.|.|..:|..|.|.:...||
Yeast   170 ----DRNGFRTIMIVGTVFHVA--GLFATANSTKYWHFILSFAIVCGFGNGIVLSPLVSVPAHYF 228

  Fly   170 EKWRALATGVAMCGSGVGTFVF----------------------------------APLTKILLK 200
            .|.|..|..:|..|..||..||                                  ..|:.||:|
Yeast   229 FKRRGTALAMATIGGSVGGVVFPIMLRSFFSMKSDTDPTYGFVWGIRTLGFLDLALLTLSIILVK 293

  Fly   201 --------------SGWRYTLAIQGIIVLSC 217
                          |.|||.|.   :.:|.|
Yeast   294 ERLPHVIENSKDGESRWRYILR---VYILQC 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8468NP_610940.1 MFS 50..>227 CDD:119392 57/236 (24%)
MFS <481..658 CDD:119392
MCH5NP_014951.4 MFS_MCT_SLC16 106..510 CDD:340910 58/237 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343225
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.