DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8468 and MCH2

DIOPT Version :9

Sequence 1:NP_610940.1 Gene:CG8468 / 36577 FlyBaseID:FBgn0033913 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_012701.2 Gene:MCH2 / 853659 SGDID:S000001704 Length:473 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:61/228 - (26%)
Similarity:103/228 - (45%) Gaps:20/228 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NIKEENEGEEEIEEAAVVVPPDSGWAWVVMVASFLCCTVIDG-----IVFCSGLIQEQLMAEFGV 83
            |.|::..|...|.    :..||.|:.|.:::|..|......|     .::.:..::....|  |.
Yeast    20 NGKDDINGNTSIS----IEVPDGGYGWFILLAFILYNFSTWGANSGYAIYLAHYLENNTFA--GG 78

  Fly    84 SKAYVAFVSSLLSGCYLMAGPFVSAMANRFGFRPVTITGAIFAAICFGLSYFATSVEYLFLIYGV 148
            ||...|.:..|...|.|...|.::.:.:.|..:.:...|.:|......|:.|:.::..::|..||
Yeast    79 SKLDYASIGGLAFSCGLFFAPVITWLYHIFSIQFIIGLGILFQGAALLLAAFSVTLWEIYLTQGV 143

  Fly   149 LGGIGFCMVYIPAVVIIGFYFEKWRALATGVAMCGSGVGTFVF-APLTKILLKSGWRYTLAIQGI 212
            |.|.|...::||:|.:|..:|...|:||:|:...|||:|..|| ..:..||.|.|.::.|..|.|
Yeast   144 LIGFGLAFIFIPSVTLIPLWFRNKRSLASGIGTAGSGLGGIVFNLGMQSILQKRGVKWALIAQCI 208

  Fly   213 IVLSCALFGLAFRPIQPITLSVTNEEGDEQEKK 245
            |..|.:...|        .|:.|..:|..|.|:
Yeast   209 ICTSLSTIAL--------MLTRTTHQGLRQHKR 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8468NP_610940.1 MFS 50..>227 CDD:119392 49/182 (27%)
MFS <481..658 CDD:119392
MCH2NP_012701.2 MFS_MCT_SLC16 41..428 CDD:340910 54/203 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I1250
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000033
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X70
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.