DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS23 and RPS23A

DIOPT Version :9

Sequence 1:NP_001286410.1 Gene:RpS23 / 36576 FlyBaseID:FBgn0033912 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_011633.3 Gene:RPS23A / 853015 SGDID:S000003350 Length:145 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:109/142 - (76%)
Similarity:128/142 - (90%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKPRGLRTARKHVNHRRDQRWADKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAI 66
            ||||||.:|||...|||:.|||:.:|||..|||.:|::||||:||||||||||:|:|:|||||||
Yeast     4 GKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIESKQPNSAI 68

  Fly    67 RKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLL 131
            ||||||||||||||:|||||.||.||:::||||||:|||||||.|.|||||||||||||:.||||
Yeast    69 RKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLL 133

  Fly   132 ALYKEKKERPRS 143
            ||:|||||:|||
Yeast   134 ALWKEKKEKPRS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS23NP_001286410.1 PTZ00067 1..143 CDD:185422 107/140 (76%)
RPS23ANP_011633.3 PTZ00067 4..145 CDD:185422 107/140 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346268
Domainoid 1 1.000 190 1.000 Domainoid score I638
eggNOG 1 0.900 - - E1_COG0048
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H799
Inparanoid 1 1.050 227 1.000 Inparanoid score I744
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62190
OrthoFinder 1 1.000 - - FOG0002402
OrthoInspector 1 1.000 - - otm46669
orthoMCL 1 0.900 - - OOG6_100935
Panther 1 1.100 - - LDO PTHR11652
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1238
SonicParanoid 1 1.000 - - X1594
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.