DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS23 and AT5G02960

DIOPT Version :9

Sequence 1:NP_001286410.1 Gene:RpS23 / 36576 FlyBaseID:FBgn0033912 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_195916.1 Gene:AT5G02960 / 831724 AraportID:AT5G02960 Length:142 Species:Arabidopsis thaliana


Alignment Length:143 Identity:113/143 - (79%)
Similarity:123/143 - (86%) Gaps:1/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKPRGLRTARKHVNHRRDQRWADKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSA 65
            |||.||:...||....|.:||||||.|||:|||..|| .||.|:||||||||||:|:||||||||
plant     1 MGKTRGMGAGRKLKRLRINQRWADKQYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSA 64

  Fly    66 IRKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSL 130
            ||||.|||||||||||.||||.||.|||||||||||:|||||||||||||||||||||||:.|||
plant    65 IRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSL 129

  Fly   131 LALYKEKKERPRS 143
            |||:|||||:|||
plant   130 LALFKEKKEKPRS 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS23NP_001286410.1 PTZ00067 1..143 CDD:185422 111/141 (79%)
AT5G02960NP_195916.1 PTZ00067 1..142 CDD:185422 111/141 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 196 1.000 Domainoid score I903
eggNOG 1 0.900 - - E1_COG0048
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 230 1.000 Inparanoid score I1143
OMA 1 1.010 - - QHG62190
OrthoDB 1 1.010 - - D1402984at2759
OrthoFinder 1 1.000 - - FOG0002402
OrthoInspector 1 1.000 - - otm3179
orthoMCL 1 0.900 - - OOG6_100935
Panther 1 1.100 - - LDO PTHR11652
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1594
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.