DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS23 and MRPS12

DIOPT Version :9

Sequence 1:NP_001286410.1 Gene:RpS23 / 36576 FlyBaseID:FBgn0033912 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_066930.1 Gene:MRPS12 / 6183 HGNCID:10380 Length:138 Species:Homo sapiens


Alignment Length:88 Identity:35/88 - (39%)
Similarity:50/88 - (56%) Gaps:8/88 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEVL 101
            |..|..|....||:||.....:.|:||||.|||.||:| ..|::...|:|.:|  :.::|:..||
Human    48 KLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRL-STGREAVCFIPGEG--HTLQEHQIVL 109

  Fly   102 VAGFGRKGHAVGDIPGVRFKVVK 124
            |.| ||    ..|:|||:..||:
Human   110 VEG-GR----TQDLPGVKLTVVR 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS23NP_001286410.1 PTZ00067 1..143 CDD:185422 35/88 (40%)
MRPS12NP_066930.1 Ribosomal_S12 32..138 CDD:239466 35/88 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..56 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0048
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.