DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS23 and RGD1563705

DIOPT Version :9

Sequence 1:NP_001286410.1 Gene:RpS23 / 36576 FlyBaseID:FBgn0033912 Length:143 Species:Drosophila melanogaster
Sequence 2:XP_038938807.1 Gene:RGD1563705 / 501058 RGDID:1563705 Length:143 Species:Rattus norvegicus


Alignment Length:143 Identity:124/143 - (86%)
Similarity:128/143 - (89%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKPRGLRTARKHVNHRRDQRWADKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSA 65
            |||.|||.||||..:|||||:|.||.||||||||..|||.|||||||||||||||||||||||||
  Rat     1 MGKCRGLCTARKLRSHRRDQKWHDKQYKKAHLGTALKANLFGGASHAKGIVLEKVGVEAKQPNSA 65

  Fly    66 IRKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSL 130
            |||||||||.|.|||||||||.||.||:|||||:|||.|||||||||||||||||||||||||||
  Rat    66 IRKCVRVQLSKYGKKITAFVPNDGCLNFIEENDKVLVVGFGRKGHAVGDIPGVRFKVVKVANVSL 130

  Fly   131 LALYKEKKERPRS 143
            |||||.|||||||
  Rat   131 LALYKGKKERPRS 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS23NP_001286410.1 PTZ00067 1..143 CDD:185422 122/141 (87%)
RGD1563705XP_038938807.1 PTZ00067 1..143 CDD:185422 122/141 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353229
Domainoid 1 1.000 213 1.000 Domainoid score I2663
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 259 1.000 Inparanoid score I3046
OMA 1 1.010 - - QHG62190
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002402
OrthoInspector 1 1.000 - - otm44948
orthoMCL 1 0.900 - - OOG6_100935
Panther 1 1.100 - - O PTHR11652
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1594
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.