DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS23 and tko

DIOPT Version :9

Sequence 1:NP_001286410.1 Gene:RpS23 / 36576 FlyBaseID:FBgn0033912 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001245490.1 Gene:tko / 31228 FlyBaseID:FBgn0003714 Length:154 Species:Drosophila melanogaster


Alignment Length:94 Identity:37/94 - (39%)
Similarity:55/94 - (58%) Gaps:8/94 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGSLNYIE 95
            |:.||....|..|...|||:||:.:..:.|:||||.||||.|:| ..||::.|::|..|. |..|
  Fly    56 HIKTRPPRQPLDGKPFAKGVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIGH-NLQE 118

  Fly    96 ENDEVLVAGFGRKGHAVGDIPGVRFKVVK 124
            .|  :::...||    :.|:|||:.|.|:
  Fly   119 HN--IVLCRVGR----LQDVPGVKLKAVR 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS23NP_001286410.1 PTZ00067 1..143 CDD:185422 37/94 (39%)
tkoNP_001245490.1 Ribosomal_S12 46..152 CDD:239466 37/94 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445051
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0048
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11652
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.