DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS23 and tko

DIOPT Version :10

Sequence 1:NP_610939.2 Gene:RpS23 / 36576 FlyBaseID:FBgn0033912 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001245490.1 Gene:tko / 31228 FlyBaseID:FBgn0003714 Length:154 Species:Drosophila melanogaster


Alignment Length:94 Identity:37/94 - (39%)
Similarity:55/94 - (58%) Gaps:8/94 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGSLNYIE 95
            |:.||....|..|...|||:||:.:..:.|:||||.||||.|:| ..||::.|::|..|. |..|
  Fly    56 HIKTRPPRQPLDGKPFAKGVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIGH-NLQE 118

  Fly    96 ENDEVLVAGFGRKGHAVGDIPGVRFKVVK 124
            .|  :::...||    :.|:|||:.|.|:
  Fly   119 HN--IVLCRVGR----LQDVPGVKLKAVR 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS23NP_610939.2 PTZ00067 1..143 CDD:185422 37/94 (39%)
tkoNP_001245490.1 Ribosomal_S12 46..152 CDD:239466 37/94 (39%)

Return to query results.
Submit another query.