DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS23 and rps2302

DIOPT Version :9

Sequence 1:NP_001286410.1 Gene:RpS23 / 36576 FlyBaseID:FBgn0033912 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_596187.1 Gene:rps2302 / 2541369 PomBaseID:SPBP4H10.13 Length:143 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:108/143 - (75%)
Similarity:125/143 - (87%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKPRGLRTARKHVNHRRDQRWADKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSA 65
            ||||.||..|||..||||::||||..|||..|||.:|::||||:|||||||:||:||||||||||
pombe     1 MGKPAGLNAARKLRNHRREERWADAHYKKRLLGTAYKSSPFGGSSHAKGIVVEKIGVEAKQPNSA 65

  Fly    66 IRKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSL 130
            |||||||||||||||:|||||.||.||:::||||||::||||||.|.||||||||||||||.|.|
pombe    66 IRKCVRVQLIKNGKKVTAFVPHDGCLNFVDENDEVLLSGFGRKGKAKGDIPGVRFKVVKVAGVGL 130

  Fly   131 LALYKEKKERPRS 143
            .||:.||||:||:
pombe   131 SALFHEKKEKPRA 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS23NP_001286410.1 PTZ00067 1..143 CDD:185422 107/141 (76%)
rps2302NP_596187.1 PTZ00067 1..143 CDD:185422 107/141 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 185 1.000 Domainoid score I773
eggNOG 1 0.900 - - E1_COG0048
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H799
Inparanoid 1 1.050 226 1.000 Inparanoid score I879
OMA 1 1.010 - - QHG62190
OrthoFinder 1 1.000 - - FOG0002402
OrthoInspector 1 1.000 - - otm47127
orthoMCL 1 0.900 - - OOG6_100935
Panther 1 1.100 - - LDO PTHR11652
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1594
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.