DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS23 and Mrps12

DIOPT Version :9

Sequence 1:NP_001286410.1 Gene:RpS23 / 36576 FlyBaseID:FBgn0033912 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001347179.1 Gene:Mrps12 / 24030 MGIID:1346333 Length:139 Species:Mus musculus


Alignment Length:128 Identity:47/128 - (36%)
Similarity:64/128 - (50%) Gaps:24/128 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RGLRTARKHVNHRRDQRWADKD---YKKAH-LGTR----WKANPFGGASHAKGIVLEKVGVEAKQ 61
            |||..|        .|.||.:.   ..:.| ||.|    .:..|..|....||:||.....:.|:
Mouse    16 RGLALA--------PQLWAARSMATLNQMHRLGPRKEPPKRLGPTEGRPQLKGVVLRTFIRKPKK 72

  Fly    62 PNSAIRKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVK 124
            ||||.|||.||:| ..||:...|:|.:|  :.::|:..|||.| ||    ..|:|||:.|||:
Mouse    73 PNSANRKCCRVRL-STGKEAVCFIPGEG--HTLQEHHVVLVEG-GR----TQDLPGVKLKVVR 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS23NP_001286410.1 PTZ00067 1..143 CDD:185422 47/128 (37%)
Mrps12NP_001347179.1 Ribosomal_S12 32..138 CDD:239466 40/104 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0048
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.