DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS23 and rps-23

DIOPT Version :9

Sequence 1:NP_001286410.1 Gene:RpS23 / 36576 FlyBaseID:FBgn0033912 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_502365.1 Gene:rps-23 / 178188 WormBaseID:WBGene00004492 Length:143 Species:Caenorhabditis elegans


Alignment Length:143 Identity:120/143 - (83%)
Similarity:132/143 - (92%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKPRGLRTARKHVNHRRDQRWADKDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSA 65
            ||||:||.||||...||::|||.||.|||||:|||||:||||||||||||||||:||||||||||
 Worm     1 MGKPKGLCTARKLKTHRQEQRWNDKRYKKAHIGTRWKSNPFGGASHAKGIVLEKIGVEAKQPNSA 65

  Fly    66 IRKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSL 130
            |||||||||||||||||||||.||.||::||||||||:||||.|||||||||||||:|||||.||
 Worm    66 IRKCVRVQLIKNGKKITAFVPNDGCLNFVEENDEVLVSGFGRSGHAVGDIPGVRFKIVKVANTSL 130

  Fly   131 LALYKEKKERPRS 143
            :||:|.|||||||
 Worm   131 IALFKGKKERPRS 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS23NP_001286410.1 PTZ00067 1..143 CDD:185422 118/141 (84%)
rps-23NP_502365.1 PTZ00067 1..143 CDD:185422 118/141 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166777
Domainoid 1 1.000 209 1.000 Domainoid score I1653
eggNOG 1 0.900 - - E1_COG0048
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H799
Inparanoid 1 1.050 252 1.000 Inparanoid score I1982
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62190
OrthoDB 1 1.010 - - D1402984at2759
OrthoFinder 1 1.000 - - FOG0002402
OrthoInspector 1 1.000 - - oto20706
orthoMCL 1 0.900 - - OOG6_100935
Panther 1 1.100 - - LDO PTHR11652
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1238
SonicParanoid 1 1.000 - - X1594
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.