DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and ROX1

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_015390.1 Gene:ROX1 / 856178 SGDID:S000006269 Length:368 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:61/248 - (24%)
Similarity:103/248 - (41%) Gaps:70/248 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RIRRPMNAFMVWAKIERKKLAD-------ENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERL 271
            :|.||.|||:::.:...:.|.|       |.|  ||:::||::|.||:.|.|:|:..:...||:.
Yeast     9 KIPRPKNAFILFRQHYHRILIDEWTAQGVEIP--HNSNISKIIGTKWKGLQPEDKAHWENLAEKE 71

  Fly   272 RVIHMTEHPNYKYRPRRRKQSK----------LRAMQPGGKEQSESSP----------------- 309
            ::.|..::|.|||:|.|:.:.|          .:..|...::|.:|.|                 
Yeast    72 KLEHERKYPEYKYKPVRKSKKKQLLLKEIEQQQQQQQKEQQQQKQSQPQLQQPFNNNIVLMKRAH 136

  Fly   310 --NPGTGGSKSN----------PKLATPPLATA------SSSYTTPTDESTCNSTNQNHGQSTPG 356
              :|.:..|.||          .:|..|.:.|:      |.|....|.:.|.....|...|....
Yeast   137 SLSPSSSVSSSNSYQFQLNNDLKRLPIPSVNTSNYMVSRSLSGLPLTHDKTARDLPQLSSQLNSI 201

  Fly   357 GLYEQPLKPTYSPSSVDCYSN-------ADSTEQIESLAANCPPALLNESSPT 402
            ..|..|    :.||:...|.|       |:||.|:..::     :::|.||.|
Yeast   202 PYYSAP----HDPSTRHHYLNVAQAQPRANSTPQLPFIS-----SIINNSSQT 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 26/77 (34%)
ROX1NP_015390.1 MATA_HMG-box 9..88 CDD:238685 28/80 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.