DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and NHP6B

DIOPT Version :10

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_009647.2 Gene:NHP6B / 852386 SGDID:S000002157 Length:99 Species:Saccharomyces cerevisiae


Alignment Length:76 Identity:21/76 - (27%)
Similarity:43/76 - (56%) Gaps:12/76 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 QSKSAKESRIR------------RPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTP 258
            ::|..||.:.|            |.::|:|.:|...|..:..||||:....:.::||::|::||.
Yeast     6 EAKQPKEPKKRTTRRKKDPNAPKRGLSAYMFFANENRDIVRSENPDVTFGQVGRILGERWKALTA 70

  Fly   259 QDRRPYVEEAE 269
            ::::||..:|:
Yeast    71 EEKQPYESKAQ 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 18/68 (26%)
PHA03273 305..>391 CDD:223031
NHP6BNP_009647.2 HMG-box_NHP6-like 14..94 CDD:438792 18/68 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.