Sequence 1: | NP_523739.2 | Gene: | Sox15 / 36575 | FlyBaseID: | FBgn0005613 | Length: | 784 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004180.1 | Gene: | SOX14 / 8403 | HGNCID: | 11193 | Length: | 240 | Species: | Homo sapiens |
Alignment Length: | 239 | Identity: | 71/239 - (29%) |
---|---|---|---|
Similarity: | 109/239 - (45%) | Gaps: | 68/239 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 209 SAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRV 273
Fly 274 IHMTEHPNYKYRPRRRKQSKLR--------------------AMQPGGKEQSESSP--------- 309
Fly 310 --------NPGTGGSKSNPKLATPP--LATASSSYT------------------------TPTDE 340
Fly 341 S---TCNSTNQNHGQSTPGGLYEQPLKPTYSPSSVDCYSNADST 381 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox15 | NP_523739.2 | SOX-TCF_HMG-box | 214..285 | CDD:238684 | 39/70 (56%) |
SOX14 | NP_004180.1 | SOX-TCF_HMG-box | 7..78 | CDD:238684 | 39/70 (56%) |
SOXp | 77..>118 | CDD:403523 | 7/40 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000028 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10270 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R685 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.940 |