DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and HMGB3

DIOPT Version :10

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001031075.1 Gene:HMGB3 / 838659 AraportID:AT1G20696 Length:147 Species:Arabidopsis thaliana


Alignment Length:71 Identity:21/71 - (29%)
Similarity:42/71 - (59%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 GTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHN-ADLSKMLGKKWRSLTPQDRRPYVEE 267
            |.:..:...::.:||.:||.|:.:..|....:|:|...: |.:.|..|:||:||:..::.|||.:
plant    24 GAKGAAKDPNKPKRPSSAFFVFMEDFRVTYKEEHPKNKSVAAVGKAGGEKWKSLSDSEKAPYVAK 88

  Fly   268 AERLRV 273
            |::.:|
plant    89 ADKRKV 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 20/61 (33%)
PHA03273 305..>391 CDD:223031
HMGB3NP_001031075.1 HMG-box_AtHMGB1-like 36..96 CDD:438821 20/59 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.