DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and SOX7

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_113627.1 Gene:SOX7 / 83595 HGNCID:18196 Length:388 Species:Homo sapiens


Alignment Length:392 Identity:121/392 - (30%)
Similarity:166/392 - (42%) Gaps:131/392 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 RPGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYV 265
            ||.|.:   ..||||||||||||||||.|||:||.:|||||||:|||||||.|::||...:||||
Human    34 RPPGDK---GSESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYV 95

  Fly   266 EEAERLRVIHMTEHPNYKYRPRRRKQSK--LRAMQPG------------------------GKEQ 304
            :||||||:.||.::|||||||||:||:|  .:.:.||                        |:::
Human    96 DEAERLRLQHMQDYPNYKYRPRRKKQAKRLCKRVDPGFLLSSLSRDQNALPEKRSGSRGALGEKE 160

  Fly   305 SESSPNPGT---------------GGSKSNPK--------LATPP-------LATASSSYTTPTD 339
            .....:|||               ||....|.        |.|||       |....:.:::|..
Human   161 DRGEYSPGTALPSLRGCYHEGPAGGGGGGTPSSVDTYPYGLPTPPEMSPLDVLEPEQTFFSSPCQ 225

  Fly   340 ESTCNSTNQNHGQ-----STPGGLYEQPLKPTYSPSSVDCYSNADSTEQIESLA----------- 388
            |        .||.     ..||    .|..|.|:||.:.|      :..:.|||           
Human   226 E--------EHGHPRRIPHLPG----HPYSPEYAPSPLHC------SHPLGSLALGQSPGVSMMS 272

  Fly   389 --ANCPPALLNESSPTGGGYDNSLL--LKKLTKPSPSRAAKSRQEKLAKSE-----EKNKGSQ-- 442
              ..|||:....|..|.....::|.  |.:|: |.|........::|::.|     ::|:..|  
Human   273 PVPGCPPSPAYYSPATYHPLHSNLQAHLGQLS-PPPEHPGFDALDQLSQVELLGDMDRNEFDQYL 336

  Fly   443 ---SQGQSQQGIYAAT--------YPLAPTSVAVVAARGMYVTCNNRGLLDHGHSVKGTFYPPVS 496
               ....|..|..|.:        .|..||..::::.           |.|    ...|:|...|
Human   337 NTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLISV-----------LAD----ATATYYNSYS 386

  Fly   497 VS 498
            ||
Human   387 VS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 52/70 (74%)
SOX7NP_113627.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..46 6/14 (43%)
SOX-TCF_HMG-box 44..115 CDD:238684 52/70 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..197 7/56 (13%)
Sox_C_TAD 198..386 CDD:288887 44/221 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5958
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm40697
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.