DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and TCF7L1

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_006712172.1 Gene:TCF7L1 / 83439 HGNCID:11640 Length:589 Species:Homo sapiens


Alignment Length:515 Identity:105/515 - (20%)
Similarity:172/515 - (33%) Gaps:174/515 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PSYDH--------EHPHHL-----LTNYNSKKY----PHVSRTPEYSHST-GSDYPEHGGYLTD- 48
            ||..|        :||||:     |..|::..:    |....:||....| |...|.|...|:. 
Human   170 PSPAHLSNKVPVVQHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTAGIPRPPHPSELSPY 234

  Fly    49 --------GRLMHE-----SNSDAGIYHVRQGS-EHSSPSLHSPAIQSSGYENEHLNEAVLAAHS 99
                    |::.|.     ......:|.:..|. .|..|:|...|..||          ::::..
Human   235 YPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSS----------LVSSRF 289

  Fly   100 HSHSPMPMVSSAYVGGGTASGSLINSNIPLLGGGGNSVLNKFLSHPHAGMVGGGTGQMEDCTSHS 164
            ..|    ||:.|:.|            :|..|            .||..:|             |
Human   290 SPH----MVAPAHPG------------LPTSG------------IPHPAIV-------------S 313

  Fly   165 PIEAASMWSYDYKGDLCAPNCGYLERHKPLPADLK-----YRPGGTQSKSAKESRIRRPMNAFMV 224
            ||                      .:.:|.|..|.     ..|...:.:..|:..:::|:||||:
Human   314 PI----------------------VKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFML 356

  Fly   225 WAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHP------NYK 283
            :.|..|.|:..|.....:|.::::||:||.:|:.:::..|.|.|.:.|.:|...:|      ||.
Human   357 YMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYG 421

  Fly   284 YRPRRRKQSKLRAMQPGGKEQSESSPNPGTGGSKSNPKLATPPLATASSSYTTPTDESTCNSTNQ 348
            .:.:|:::.:|...|    .|.:.....|...|||.....         .|..|  |..|:|...
Human   422 KKKKRKREKQLSQTQ----SQQQVQEAEGALASKSKKPCV---------QYLPP--EKPCDSPAS 471

  Fly   349 NHGQ-----STPGGLYEQPLKPTYSPSSVDCYSNADSTEQIESLAANCPPALLNESSPTGGGYDN 408
            :||.     :||......|..|.           |..:||.:.|:..                  
Human   472 SHGSMLDSPATPSAALASPAAPA-----------ATHSEQAQPLSLT------------------ 507

  Fly   409 SLLLKKLTKPSPSRAAKSRQEKLAKSEEKNKGSQSQGQSQQGIYAATYPLAPTSVAVVAA 468
                   |||. :||..:.......|.:....|..|..||..:.:...||.....|::|:
Human   508 -------TKPE-TRAQLALHSAAFLSAKAAASSSGQMGSQPPLLSRPLPLGSMPTALLAS 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 23/76 (30%)
TCF7L1XP_006712172.1 CTNNB1_binding 30..251 CDD:285538 19/80 (24%)
SOX-TCF_HMG-box 346..417 CDD:238684 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.