DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and HMGB5

DIOPT Version :10

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_195282.1 Gene:HMGB5 / 829709 AraportID:AT4G35570 Length:125 Species:Arabidopsis thaliana


Alignment Length:73 Identity:21/73 - (28%)
Similarity:41/73 - (56%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 LKYRPGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHN-ADLSKMLGKKWRSLTPQDR 261
            ||.|......|:...:|.::|.:.|.|:....||:....|||..: .::.:..||||:::|.::|
plant    17 LKVRGNKVGKKTKDPNRPKKPPSPFFVFLDDFRKEFNLANPDNKSVGNVGRAAGKKWKTMTEEER 81

  Fly   262 RPYVEEAE 269
            .|:|.:::
plant    82 APFVAKSQ 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 17/57 (30%)
PHA03273 305..>391 CDD:223031
HMGB5NP_195282.1 HMG-box_AtHMGB1-like 35..95 CDD:438821 16/55 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.