DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and 3xHMG-box1

DIOPT Version :10

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_192846.1 Gene:3xHMG-box1 / 826709 AraportID:AT4G11080 Length:446 Species:Arabidopsis thaliana


Alignment Length:102 Identity:26/102 - (25%)
Similarity:60/102 - (58%) Gaps:10/102 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 QSKSAKES-RIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAE 269
            ::|..|:. :.::|::|::::|...|..|..||..:  .:::||.|::|::|:.:.:.||.:.|:
plant   236 KAKKIKDPLKPKQPISAYLIYANERRAALKGENKSV--IEVAKMAGEEWKNLSEEKKAPYDQMAK 298

  Fly   270 RLRVIHMTEHPNYKYRPRRRKQSKLRAMQPGGKEQSE 306
            :.:.|::.|...||    |.|:.:..:.:   ||:.|
plant   299 KNKEIYLQEMEGYK----RTKEEEAMSQK---KEEEE 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 19/74 (26%)
PHA03273 305..>391 CDD:223031 1/2 (50%)
3xHMG-box1NP_192846.1 PTZ00121 <11..361 CDD:173412 26/102 (25%)
HMG-box_AtHMGB6-like_rpt1 130..197 CDD:438822
HMG-box_AtHMGB6-like_rpt2 246..311 CDD:438823 17/66 (26%)
HMG-box_AtHMGB6-like_rpt3 363..440 CDD:438824
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.