DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and HMGB1

DIOPT Version :10

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_974413.1 Gene:HMGB1 / 824351 AraportID:AT3G51880 Length:185 Species:Arabidopsis thaliana


Alignment Length:146 Identity:34/146 - (23%)
Similarity:58/146 - (39%) Gaps:27/146 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 PADLKYRPGGTQSKSAKE--SRIRRPMNAFMVWAKIERKKLADENPDLHNAD-LSKMLGKKWRSL 256
            ||:...:....:.|.||:  ::.:|..:||.|:.:..|.....|||::.... :.|..|:||:|:
plant    31 PAEKPTKRETRKEKKAKKDPNKPKRAPSAFFVFLEDFRVTFKKENPNVKAVSAVGKAGGQKWKSM 95

  Fly   257 TPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQSKLRAMQPGGKEQSESSPNPGTGGSKSNPK 321
            :..::.||.|:|                  .:||....:.|....|...|.|.......|:.|.:
plant    96 SQAEKAPYEEKA------------------AKRKAEYEKQMDAYNKNLEEGSDESEKSRSEINDE 142

  Fly   322 LATPPLATASSSYTTP 337
                  ..||...|.|
plant   143 ------DEASGEVTIP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 17/75 (23%)
PHA03273 305..>391 CDD:223031 8/33 (24%)
HMGB1NP_974413.1 PRK05901 1..>171 CDD:235640 34/146 (23%)
HMG-box_AtHMGB1-like 54..114 CDD:438821 19/77 (25%)

Return to query results.
Submit another query.