DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox18

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_017209261.1 Gene:sox18 / 797246 ZFINID:ZDB-GENE-080725-1 Length:431 Species:Danio rerio


Alignment Length:257 Identity:104/257 - (40%)
Similarity:134/257 - (52%) Gaps:46/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 GGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEE 267
            |.::.||..||||||||||||||||.|||:||.:|||||||.||||||:.|::|:..|:||:|||
Zfish    82 GSSEGKSGGESRIRRPMNAFMVWAKDERKRLAIQNPDLHNAVLSKMLGQSWKALSTLDKRPFVEE 146

  Fly   268 AERLRVIHMTEHPNYKYRPRRRKQ-SKLRAMQPGGKEQSESSPNPGTGGS-KSNPKLATPPL--- 327
            |||||:.|:.:||||||||||:|| .|::.::||...|..:...||...| ..:.....|||   
Zfish   147 AERLRLQHLQDHPNYKYRPRRKKQPKKMKRVEPGLLLQGLAHGGPGDAYSPHRHAHHLLPPLGHF 211

  Fly   328 -------ATASSSYTTPTDE-STCNSTNQNHGQST--------PGGL-----YEQPLKPTYSP-- 369
                   |....|:..||.| |..:...:..|.|.        ..||     |.|  .|.:.|  
Zfish   212 RDLHPSGAPELESFGLPTPEMSPLDVLEEGGGDSVFFPPHMQEDVGLSSWINYHQ--HPNHQPGH 274

  Fly   370 ----SSVDCYSNADSTEQIESLAANCPP----ALLNESSPTGGGYDNSLLLKKLTKPSPSRA 423
                :|.:...:.....|...||  |.|    .|:.||...||.|.|      :|.|..|:|
Zfish   275 HPHHNSHNLQHSHPHLNQKSPLA--CLPLQEKCLVVESPNPGGLYPN------MTLPESSKA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 51/70 (73%)
sox18XP_017209261.1 SOX-TCF_HMG-box 93..164 CDD:238684 51/70 (73%)
Sox_C_TAD 207..429 CDD:288887 33/132 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5813
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm24659
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.