DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and TCF7

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_006714741.1 Gene:TCF7 / 6932 HGNCID:11639 Length:460 Species:Homo sapiens


Alignment Length:398 Identity:87/398 - (21%)
Similarity:145/398 - (36%) Gaps:108/398 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PSYDHEHPHHLLTNYNSKKYPH-VSRTPEYSHSTGSDYPEHGGYLTDGRLMH---ESNSDAGIYH 63
            ||...:||......:.:.:.|| |.:...|.| ..|.:|.........:.:|   ::...:|.|.
Human   134 PSGAGQHPQPQPPLHKANQPPHGVPQLSLYEH-FNSPHPTPAPADISQKQVHRPLQTPDLSGFYS 197

  Fly    64 VRQGS----EHS----SPSLHSPAIQSSGYENEHLNEAVLAAHSHSHSPMPMVS-SAYVGGGTAS 119
            :..||    .|:    ||.|: |...|.||              ..|.|.|..: .|.....|..
Human   198 LTSGSMGQLPHTVSWPSPPLY-PLSPSCGY--------------RQHFPAPTAAPGAPYPRFTHP 247

  Fly   120 GSLINSNIPLLGGGGNSVLNKFLSHPHAGMVGGGTGQMEDCTSHSPIEAASMWSYDYKGDLCAPN 184
            ..::.|.:|              .||.|             ..|..|               .|.
Human   248 SLMLGSGVP--------------GHPAA-------------IPHPAI---------------VPP 270

  Fly   185 CGYLERHKPLPADLKYRPGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKML 249
            .|..|. :|...:||.:......|.||:..|::|:||||::.|..|.|:..|.....:|.::::|
Human   271 SGKQEL-QPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQIL 334

  Fly   250 GKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRP---RRRKQSKLRAMQPGGKEQSESSPNP 311
            |::|.:|:.:::..|.|.|.:.|.:||..:|.:..|.   :::::|:        ::..||:.:|
Human   335 GRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSR--------EKHQESTTDP 391

  Fly   312 GTGGSKSNPKLATPPLATASSSYTTPTDE-STCNSTNQNH-----------GQSTPGGLYEQPLK 364
            |           :|....|.......||. ..|.....:|           ....|.||...||.
Human   392 G-----------SPKKCRARFGLNQQTDWCGPCRWVCPHHRSPFALSCFPDSAHVPLGLQPTPLA 445

  Fly   365 PTYSPSSV 372
            |  .|:|:
Human   446 P--QPTSI 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 22/70 (31%)
TCF7XP_006714741.1 CTNNB1_binding 20..212 CDD:285538 17/78 (22%)
SOX-TCF_HMG-box 300..370 CDD:238684 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.