DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and Sox12

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001162121.1 Gene:Sox12 / 689988 RGDID:1586313 Length:314 Species:Rattus norvegicus


Alignment Length:296 Identity:82/296 - (27%)
Similarity:132/296 - (44%) Gaps:83/296 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 PG-GTQSKSAKE--------SRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLT 257
            || |..::.|:|        ..|:|||||||||::.||:|:.|:.||:|||::||.||::|:.|.
  Rat    18 PGPGPAAEGAREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQ 82

  Fly   258 PQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQ---SKLRAMQPGGKEQSESSPNPGTGGSKSN 319
            ..::.|:|.||||||:.||.::|:||||||::.:   :|.|...|||          |.|||:..
  Rat    83 DSEKIPFVREAERLRLKHMADYPDYKYRPRKKSKGAPAKARPRPPGG----------GGGGSRLK 137

  Fly   320 PKLATP----------PLATASSSYTTPTDES-----------TCNSTNQNHGQSTPGGLYEQ-P 362
            |....|          ||...:::   |.|:.           ...:..:...:..|.|...: |
  Rat   138 PGPQLPGRGGRRATGGPLGGGAAA---PEDDDEDEEEELLEVRLLETPGRELWRMVPAGRAARGP 199

  Fly   363 LKPTYSPSSVDCYSNADSTEQIESLAANCPPALLNESSPTGGGYDNSLLLKKLTKPSPSRAAKSR 427
            .:....|||....::|.|            |.|..:..|                       :..
  Rat   200 AERAQGPSSEGAAASAAS------------PTLSEDEEP-----------------------EEE 229

  Fly   428 QEKLAKSEEKNKGSQSQGQSQQGIYAATYPLAPTSV 463
            :|:.|.:||..:.:.:.|:...| :.:..|..||.:
  Rat   230 EEEAATAEEGEEETVASGEEPLG-FLSRMPPGPTGL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 38/70 (54%)
Sox12NP_001162121.1 SOX-TCF_HMG-box 39..110 CDD:238684 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342400
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.