DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and SOX2

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_003097.1 Gene:SOX2 / 6657 HGNCID:11195 Length:317 Species:Homo sapiens


Alignment Length:273 Identity:85/273 - (31%)
Similarity:134/273 - (49%) Gaps:60/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 GGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEE 267
            ||.|..|  ..|::|||||||||::.:|:|:|.|||.:||:::||.||.:|:.|:..::||:::|
Human    31 GGNQKNS--PDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDE 93

  Fly   268 AERLRVIHMTEHPNYKYRPRRRKQSKLR---------AMQPGGKEQSESSPNPGTG-GSKSNPKL 322
            |:|||.:||.|||:|||||||:.::.::         .:.|||...: |....|.| |:..|.::
Human    94 AKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA-SGVGVGAGLGAGVNQRM 157

  Fly   323 ATPPLAT--ASSSYTTPTDESTCNSTNQNHGQSTPGGLYEQPL---------------------- 363
            .:.....  ::.||:...|:.   ...|:.|.:..|....||:                      
Human   158 DSYAHMNGWSNGSYSMMQDQL---GYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNG 219

  Fly   364 KPTYSPSSVDCYSNADST--------EQIESLAANCPPALLNES---SPTGGGYDN---SLLLKK 414
            .||||.|    ||...:.        ..::|.|::.||.:.:.|   :|...|...   |:.|..
Human   220 SPTYSMS----YSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPG 280

  Fly   415 LTKPSPSRAAKSR 427
            ...|.|  ||.||
Human   281 AEVPEP--AAPSR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 38/70 (54%)
SOX2NP_003097.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 5/13 (38%)
SOX-TCF_HMG-box 40..111 CDD:238684 38/70 (54%)
SOXp 110..200 CDD:315092 21/93 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..266 6/22 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.