DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox15 and sox19b

DIOPT Version :9

Sequence 1:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_571777.1 Gene:sox19b / 64812 ZFINID:ZDB-GENE-010111-1 Length:293 Species:Danio rerio


Alignment Length:268 Identity:77/268 - (28%)
Similarity:121/268 - (45%) Gaps:81/268 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 PADLKYRPGGTQ-----------SKSA------KESRIRRPMNAFMVWAKIERKKLADENPDLHN 242
            |..|::.||.:.           ||:|      ...:::|||||||||::.:|:|:|.|||.:||
Zfish    16 PHTLQHSPGMSPPGSGVGNAHHVSKTACPPGVDPMDKVKRPMNAFMVWSRGQRRKMAQENPKMHN 80

  Fly   243 ADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQSKLRAMQPGGK----- 302
            :::||.||.:|:.||..::||:::||:|||.:||.|:|:|||:|||:.::.::.....||     
Zfish    81 SEISKRLGAEWKLLTDVEKRPFIDEAKRLRAVHMKEYPDYKYKPRRKTKALMKKDNSVGKYPLAA 145

  Fly   303 -EQSESSPNPGTGGSKSNPKLATPPLATASSSYTTPTDESTCNSTNQNHGQSTPGGL-------- 358
             ....|:...|.|||   |::                         ..:|....||.        
Zfish   146 GNLLASAVAQGQGGS---PRM-------------------------DGYGWGHAGGYMGMQGDAL 182

  Fly   359 -YEQPLK---------PTYSP--SSVDCYSN---ADSTEQIESLAANCPPALLNESSPTG----- 403
             |.|.|.         |...|  :|...||.   :.|.:|...:.:...|..|:. ||||     
Zfish   183 GYPQQLHRYDLSALQYPAAQPYMNSASSYSQMSYSSSPQQPSPVMSMVKPEPLSH-SPTGVPNHH 246

  Fly   404 -GGYDNSL 410
             |.:...|
Zfish   247 RGAFQGDL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 37/70 (53%)
sox19bNP_571777.1 SOX-TCF_HMG-box 52..123 CDD:238684 37/70 (53%)
SOXp 122..203 CDD:289133 19/108 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582336
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.